7SUL: WD-repeat domain of human SEC31A

Crystal structure of the WD-repeat domain of human SEC31A. Determined by X-ray diffraction at 2.4 Å resolution. Released 1 Dec 2021.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 10,025
Mol. weight: 157.51 kDa
Released: 1 Dec 2021

Explore 7SUL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SUL contains 16 α-helices and 121 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	1
β-strand	10-14	5	2
α-helix	15-16	2
β-strand	23-28	6	2
β-strand	29	1	3
β-strand	41-47	7	2
α-helix	56-57	2
β-strand	58-65	8	2
β-strand	69	1	3
β-strand	71-75	5	4
β-strand	88-92	5	4
β-strand	98-101	4	4
α-helix	103-108	6
β-strand	114-118	5	4
β-strand	127-130	4	5
β-strand	137-141	5	5
β-strand	147-151	5	5
β-strand	159	1	5
α-helix	164-165	2
β-strand	173-176	4	6
β-strand	183-187	5	6
β-strand	193-197	5	6
β-strand	202-207	6	6
β-strand	216-221	6	7
β-strand	228-233	6	7
β-strand	241-245	5	7
β-strand	254-256	3	7
β-strand	263-268	6	8
β-strand	276-280	5	8
β-strand	285-288	4	8
β-strand	295-298	4	8
β-strand	306-311	6	1
β-strand	318-323	6	1
β-strand	327-332	6	1

Chain B: 4 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	9
β-strand	10-14	5	10
α-helix	15-16	2
β-strand	23-28	6	10
β-strand	29	1	11
β-strand	41-47	7	10
β-strand	58-65	8	10
β-strand	69-75	7	11
β-strand	88-93	6	11
β-strand	98-101	4	11
α-helix	103-108	6
β-strand	114-118	5	11
β-strand	127-130	4	12
β-strand	137-141	5	12
β-strand	147-151	5	12
β-strand	159	1	12
α-helix	164-165	2
β-strand	173-176	4	13
β-strand	183-187	5	13
β-strand	193-197	5	13
β-strand	202-207	6	13
β-strand	216-221	6	14
β-strand	228-233	6	14
β-strand	241-245	5	14
α-helix	246-248	3
β-strand	254-256	3	14
β-strand	263-268	6	15
β-strand	276-280	5	15
β-strand	285-288	4	15
β-strand	295-299	5	15
β-strand	306	1	16
β-strand	310-311	2	9
β-strand	318-322	5	9
β-strand	323	1	16
β-strand	328-332	5	9

Chain C: 4 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	17
β-strand	10-14	5	18
α-helix	15-16	2
β-strand	22-28	7	18
β-strand	29	1	19
β-strand	42-48	7	18
α-helix	56-57	2
β-strand	58-64	7	18
β-strand	69-75	7	19
β-strand	88-93	6	19
β-strand	98-101	4	19
α-helix	103-108	6
β-strand	114-118	5	19
β-strand	127-130	4	20
β-strand	137-141	5	20
β-strand	147-151	5	20
β-strand	159	1	20
α-helix	164-165	2
β-strand	173-176	4	21
β-strand	183-187	5	21
β-strand	193-197	5	21
β-strand	202-207	6	21
β-strand	216-221	6	22
β-strand	228-233	6	22
β-strand	241-245	5	22
β-strand	254-256	3	22
β-strand	263-268	6	23
β-strand	276-280	5	23
β-strand	285-289	5	23
β-strand	294-299	6	23
β-strand	306-311	6	17
β-strand	319-323	5	17
β-strand	327-331	5	17

Chain D: 4 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	1-7	7	24
β-strand	10-14	5	25
α-helix	15-16	2
β-strand	22-28	7	25
β-strand	29	1	26
β-strand	42-48	7	25
β-strand	56	1	24
β-strand	58-64	7	25
β-strand	69	1	26
β-strand	71-75	5	27
β-strand	88-92	5	27
β-strand	98-101	4	27
α-helix	103-108	6
β-strand	114-118	5	27
β-strand	127-130	4	28
β-strand	137-141	5	28
β-strand	147-151	5	28
β-strand	154-159	6	28
α-helix	164-165	2
β-strand	173-176	4	29
β-strand	183-187	5	29
β-strand	193-197	5	29
β-strand	202-207	6	29
β-strand	216-221	6	30
β-strand	228-233	6	30
β-strand	241-245	5	30
α-helix	246-248	3
β-strand	254-256	3	30
β-strand	263-268	6	31
β-strand	276-280	5	31
β-strand	285-288	4	31
β-strand	295-299	5	31
β-strand	306-311	6	24
β-strand	318-323	6	24
β-strand	327-332	6	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein transport protein Sec31A	A, B, C, D	protein	356	Homo sapiens	O94979 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7SUL_1 Protein transport protein Sec31A (chains A, B, C, D)
MHHHHHHSSGRENLYFQGMKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNAS
LEIFELDLSDPSLDMKSCATFSSSHRYHKLIWGPYKMDSKGDVSGVLIAGGENGNIILYD
PSKIIAGDKEVVIAQNDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPG
AKTQPPEDISCIAWNRQVQHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWH
PDVATQMVLASEDDRLPVIQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCGKD
AKILCSNPNTGEVLYELPTNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGST

Primary citation

Crystal structure of the WD-repeat domain of human SEC31A. Zeng, H., Dong, A., Loppnau, P. et al. To be published.

Other PDB entries of the same protein (UniProt O94979 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3WXA 2.36 Å, X-ray crystal structural analysis of the complex between ALG-2 and Sec31A peptide

Browse structure collections

About this viewer

MolViewer shows 7SUL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.