3WXA: Programmed cell death protein 6

X-ray crystal structural analysis of the complex between ALG-2 and Sec31A peptide. Determined by X-ray diffraction at 2.36 Å resolution. Released 11 Mar 2015.

Method: X-ray diffraction
Resolution: 2.36 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,998
Mol. weight: 43.53 kDa
Ligands: ZN
Released: 11 Mar 2015

Explore 3WXA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WXA contains 24 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	27-35	9
β-strand	43-44	2	1
α-helix	45-49	5
β-strand	52-53	2	2
α-helix	59-60	2
α-helix	62-72	11
β-strand	79-80	2	1
α-helix	82-102	21
β-strand	110	1	3
α-helix	112-115	4
α-helix	119-122	4
α-helix	125-127	3
α-helix	128-130	3
α-helix	131-138	8
β-strand	146	1	3
α-helix	148-168	21
β-strand	175-179	5	4
α-helix	180-188	9

Chain B: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
β-strand	43	1	5
α-helix	45-49	5
β-strand	52-53	2	6
α-helix	59-61	3
α-helix	62-72	11
β-strand	80	1	5
α-helix	82-102	21
β-strand	110	1	7
α-helix	112-118	7
α-helix	119-121	3
α-helix	130-138	9
β-strand	146	1	7
α-helix	148-168	21
β-strand	175-179	5	4
α-helix	180-187	8

Chains C and D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	6-7	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death protein 6	A, B	protein	172	Homo sapiens	O75340 (AlphaFold model)
Protein transport protein Sec31A	C, D	protein	12	Homo sapiens	O94979 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3WXA_1 Programmed cell death protein 6 (chains A, B)
AALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAG
VNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFD
RQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV

Sequence of entity 2 (C, D), FASTA

>3WXA_2 Protein transport protein Sec31A (chains C, D)
NPPPPGFIMHGN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	10

Primary citation

Structural Analysis of the Complex between Penta-EF-Hand ALG-2 Protein and Sec31A Peptide Reveals a Novel Target Recognition Mechanism of ALG-2. Takahashi, T., Kojima, K., Zhang, W. et al. Int J Mol Sci (2015) 16:3677-3699. DOI 10.3390/ijms16023677 · PubMed

Other PDB entries of the same protein (UniProt O75340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZND 1.7 Å, Crystal structure of Ca2+-free form of des3-20ALG-2
2ZNE 2.2 Å, Crystal structure of Zn2+-bound form of des3-23ALG-2 complexed with Alix ABS peptide
5GQQ 2.2 Å, Structure of ALG-2/HEBP2 Complex
2ZN9 2.4 Å, Crystal structure of Ca2+-bound form of des3-20ALG-2
3AAJ 2.4 Å, Crystal structure of Ca2+-bound form of des3-23ALG-2deltaGF122
2ZN8 2.7 Å, Crystal structure of Zn2+-bound form of ALG-2
3AAK 2.7 Å, Crystal structure of Zn2+-bound form of des3-20ALG-2F122A
2ZRS 3.1 Å, Crystal structure of Ca2+-bound form of des3-23ALG-2
2ZRT 3.3 Å, Crystal structure of Zn2+-bound form of des3-23ALG-2

Browse structure collections

About this viewer

MolViewer shows 3WXA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.