BIO-2895 (BRD0705) bound GSK3alpha-axin complex. Determined by X-ray diffraction at 1.94 Å resolution. Released 14 Jun 2023.
Explore 7SXF in 3D Show helices and sheets RCSB PDB PDBe
7SXF contains 26 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 102-107 | 6 | 1 |
| β-strand | 114-118 | 5 | 1 |
| β-strand | 120-126 | 7 | 1 |
| β-strand | 132-137 | 6 | 1 |
| β-strand | 144-152 | 9 | 1 |
| α-helix | 159-166 | 8 | |
| β-strand | 172 | 1 | 2 |
| β-strand | 175-182 | 8 | 1 |
| β-strand | 189-196 | 8 | 1 |
| β-strand | 200-201 | 2 | 2 |
| α-helix | 202-211 | 10 | |
| α-helix | 215-217 | 3 | |
| α-helix | 218-237 | 20 | |
| β-strand | 241 | 1 | 3 |
| α-helix | 247-249 | 3 | |
| β-strand | 250-252 | 3 | 2 |
| β-strand | 259-261 | 3 | 2 |
| α-helix | 264-266 | 3 | |
| β-strand | 268 | 1 | 3 |
| α-helix | 283-285 | 3 | |
| α-helix | 288-291 | 4 | |
| α-helix | 300-315 | 16 | |
| α-helix | 325-336 | 12 | |
| α-helix | 339-340 | 2 | |
| α-helix | 341-347 | 7 | |
| α-helix | 349-351 | 3 | |
| α-helix | 359-363 | 5 | |
| α-helix | 364-366 | 3 | |
| α-helix | 369 | 1 | |
| α-helix | 374-383 | 10 | |
| α-helix | 388-390 | 3 | |
| α-helix | 392-393 | 2 | |
| α-helix | 394-398 | 5 | |
| α-helix | 401-403 | 3 | |
| α-helix | 404-407 | 4 | |
| α-helix | 429-431 | 3 | |
| α-helix | 434-436 | 3 | |
| α-helix | 437-440 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 385-397 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glycogen synthase kinase-3 alpha | A | protein | 345 | Homo sapiens | P49840 (AlphaFold model) |
| Axin peptide | B | protein | 17 | Homo sapiens | O15169 (AlphaFold model) |
>7SXF_1 Glycogen synthase kinase-3 alpha (chains A) TTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRE LQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILY VKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYI CSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPT REQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAH SFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILIPPHR
>7SXF_2 Axin peptide (chains B) LLPQKFAEELIHRLEAV
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
| 6VL | (4~{S})-4-ethyl-7,7-dimethyl-4-phenyl-2,6,8,9-tetrahydropyrazolo[3,4-b]quinolin… | C20 H23 N3 O | 1 |
Elucidation of the GSK3 alpha Structure Informs the Design of Novel, Paralog-Selective Inhibitors. Amaral, B., Capacci, A., Anderson, T. et al. ACS Chem Neurosci (2023) 14:1080-1094. DOI 10.1021/acschemneuro.2c00476 · PubMed
Other PDB entries of the same protein (UniProt P49840 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7SXF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.