Solution Structure of Sds3 Capped Tudor Domain. Determined by solution NMR. Released 19 Jan 2022.
Explore 7SXI in 3D Show helices and sheets RCSB PDB PDBe
7SXI contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 255-258 | 4 | 1 |
| β-strand | 261-264 | 4 | 1 |
| β-strand | 267-269 | 3 | 1 |
| β-strand | 274-278 | 5 | 2 |
| β-strand | 285-292 | 8 | 2 |
| β-strand | 296-301 | 6 | 2 |
| β-strand | 307-311 | 5 | 2 |
| α-helix | 312-317 | 6 | |
| β-strand | 321-325 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sin3 histone deacetylase corepressor complex component SDS3 | A | protein | 79 | Mus musculus | Q8BR65 (AlphaFold model) |
>7SXI_1 Sin3 histone deacetylase corepressor complex component SDS3 (chains A) SNAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVRKTSDSTK MRIYVGQLQRGLFVIRRRS
A capped Tudor domain within a core subunit of the Sin3L/Rpd3L histone deacetylase complex binds to nucleic acid G-quadruplexes. Marcum, R.D., Hsieh, J., Giljen, M. et al. J Biol Chem (2022) 298:101558-101558. DOI 10.1016/j.jbc.2021.101558 · PubMed
Other PDB entries of the same protein (UniProt Q8BR65 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7SXI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.