7SYY: Hendra virus G protein head domain

Hendra virus G protein head domain in complex with cross-neutralizing murine antibody hAH1.3. Determined by X-ray diffraction at 2.74 Å resolution. Released 1 Jun 2022.

Method: X-ray diffraction
Resolution: 2.74 Å
Organisms: Hendra henipavirus, Mus musculus
Chains: 3
Atoms: 6,923
Mol. weight: 120.06 kDa
Ligands: ZN, NAG
Released: 1 Jun 2022

Explore 7SYY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SYY contains 20 α-helices and 78 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	178-179	2	1
β-strand	201-202	2	1
β-strand	216-225	10	2
β-strand	228-237	10	2
β-strand	244-257	14	2
β-strand	263-271	9	2
α-helix	276-278	3
β-strand	279-287	9	3
β-strand	290-297	8	3
α-helix	310-312	3
β-strand	314-320	7	3
β-strand	332-336	5	3
β-strand	340-341	2	4
β-strand	347-350	4	4
β-strand	354	1	3
β-strand	356-358	3	4
β-strand	361-371	11	4
α-helix	372-374	3
α-helix	379-381	3
α-helix	394-398	5
β-strand	407-417	11	4
β-strand	426-430	5	4
β-strand	431	1	5
α-helix	432	1
β-strand	442-447	6	6
β-strand	450-455	6	6
β-strand	465-471	7	6
β-strand	475	1	5
β-strand	476-479	4	6
β-strand	509	1	1
β-strand	511-515	5	7
β-strand	520-526	7	7
β-strand	533	1	8
β-strand	535-540	6	7
β-strand	545-550	6	7
β-strand	557	1	8
β-strand	558-568	11	1
β-strand	571-580	10	1
β-strand	588	1	2
β-strand	589-596	8	1
α-helix	597-598	2

Chain H: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	9
β-strand	10-12	3	10
β-strand	18-25	8	9
α-helix	29-31	3
β-strand	32-39	8	10
β-strand	45-51	7	10
β-strand	57-59	3	10
α-helix	61-63	3
β-strand	67-72	6	9
β-strand	77-82	6	9
α-helix	84-86	3
β-strand	88-96	9	10
β-strand	103	1	10
β-strand	107-111	5	10
β-strand	117	1	11
α-helix	118-119	2
β-strand	120-124	5	12
β-strand	135-145	11	12
β-strand	146	1	11
β-strand	151-154	4	13
β-strand	163-165	3	12
α-helix	166-168	3
β-strand	169-170	2	12
β-strand	175-184	10	12
β-strand	194-199	6	13
β-strand	204-209	6	13
α-helix	211-213	3

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	14
β-strand	10-13	4	15
β-strand	19-25	7	14
β-strand	27C	1	16
β-strand	31	1	16
β-strand	33-38	6	15
β-strand	45-49	5	15
β-strand	53-54	2	15
α-helix	55	1
β-strand	62-67	6	14
β-strand	70-75	6	14
α-helix	80-82	3
β-strand	84-90	7	15
α-helix	96	1
β-strand	97-98	2	15
β-strand	102-106	5	15
β-strand	111	1	17
β-strand	114-118	5	18
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	18
β-strand	140	1	17
β-strand	144-150	7	19
β-strand	153-154	2	19
β-strand	159-163	5	18
β-strand	173-182	10	18
α-helix	183-188	6
β-strand	191-198	8	19
α-helix	204	1
β-strand	205-210	6	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Attachment glycoprotein	A	protein	604	Hendra henipavirus	O89343 (AlphaFold model)
Antibody hAH1.3 Heavy Chain	H	protein	223	Mus musculus
Antibody hAH1.3 light chain	L	protein	221	Mus musculus

Sequence of entity 1 (A), FASTA

>7SYY_1 Attachment glycoprotein (chains A)
MMADSKLVSLNNNLSGKIKDQGKVIKNYYGTMDIKKINDGLLDSKILGAFNTVIALLGSI
IIIVMNIMIIQNYTRTTDNQALIKESLQSVQQQIKALTDKIGTEIGPKVSLIDTSSTITI
PANIGLLGSKISQSTSSINENVNDKCKFTLPPLKIHECNISCPNPLPFREYRPISQGVSD
LVGLPNQICLQKTTSTILKPRLISYTLPINTREGVCITDPLLAVDNGFFAYSHLEKIGSC
TRGIAKQRIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDFYYTLCAVSHV
GDPILNSTSWTESLSLIRLAVRPKSDSGDYNQKYIAITKVERGKYDKVMPYGPSGIKQGD
TLYFPAVGFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILRSGLLKYNLSL
GGDIILQFIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVDTVDPLRVQWR
NNSVISRPGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQTAENPVFAVF
KDNEILYQVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDSVIRPKLFAVKIPAQ
CSES

Sequence of entity 2 (H), FASTA

>7SYY_2 Antibody hAH1.3 Heavy Chain (chains H)
QIQLVQSGPELKKPGETVKISCTTSGYTFTNYGLNWVKQAPGKGFKWMAWINTYTGEPTY
ADDFKGRFAFSLETSASTTYLQINNLKNEDMSTYFCARSGYYDGLKAMDYWGQGTSVTVS
SAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC

Sequence of entity 3 (L), FASTA

>7SYY_3 Antibody hAH1.3 light chain (chains L)
DVLMIQTPLSLPVSLGDQASISCRSSQSLIHINGNTYLEWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGAGTKLELKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECVY

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Water and common crystallization additives (SO4, CL) are not listed.

Primary citation

Potent monoclonal antibody-mediated neutralization of a divergent Hendra virus variant. Wang, Z., Dang, H.V., Amaya, M. et al. Proc Natl Acad Sci U S A (2022) 119:e2122769119-e2122769119. DOI 10.1073/pnas.2122769119 · PubMed

Other PDB entries of the same protein (UniProt O89343 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VY4 2.0 Å, Crystal structure of Hendra receptor binding protein head domain in complex with human…
6PD4 2.2 Å, Crystal Structure of Hendra Virus Attachment G Glycoprotein
6VY6 2.6 Å, Crystal structure of Hendra receptor binding protein head domain in complex with human…
6CMG 2.7 Å, Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent…
6PDL 2.7 Å, Crystal Structure of Hendra Virus Attachment G Glycoprotein in Complex with Receptor…
6CMI 2.72 Å, Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent…
7SYZ 2.86 Å, Hendra virus G protein head domain in complex with cross-neutralizing murine antibody…
2X9M 2.9 Å, Hendra virus attachment glycoprotein
8VF1 3.0 Å, Crystal Structure of the Hendra Virus Attachment G glycoprotein (HeV-G)
8JR3 3.22 Å, Crystal structure of Hendra Virus attachment(G) glycoprotein mutant S586N in complex…
2VSK 3.3 Å, Hendra virus attachment glycoprotein in complex with human cell surface receptor ephrinB2
8JR5 3.3 Å, Crystal structure of Hendra Virus attachment(G) glycoprotein mutant S586N

Browse structure collections

About this viewer

MolViewer shows 7SYY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.