8VF1: Hendra Virus Attachment G glycoprotein

Crystal Structure of the Hendra Virus Attachment G glycoprotein (HeV-G). Determined by X-ray diffraction at 3.0 Å resolution. Released 19 Mar 2025.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Henipavirus hendraense
Chains: 2
Atoms: 6,770
Mol. weight: 104.41 kDa
Ligands: NAG
Released: 19 Mar 2025

Explore 8VF1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VF1 contains 17 α-helices and 67 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	201-202	2	1
α-helix	203	1
β-strand	204	1	2
β-strand	215-222	8	2
β-strand	225	1	2
β-strand	228-237	10	2
α-helix	243	1
β-strand	244-256	13	2
β-strand	264-271	8	2
α-helix	276-278	3
β-strand	279-287	9	3
β-strand	290-297	8	3
α-helix	310-312	3
β-strand	314-320	7	3
β-strand	332-335	4	3
β-strand	339-341	3	4
β-strand	347-350	4	4
β-strand	354	1	3
β-strand	356-358	3	4
β-strand	361-371	11	4
α-helix	372-374	3
α-helix	379-381	3
α-helix	394-397	4
β-strand	407-417	11	4
β-strand	425-430	6	4
β-strand	431	1	5
β-strand	442-447	6	6
β-strand	450-455	6	6
β-strand	465-471	7	6
β-strand	475	1	5
β-strand	476-479	4	6
β-strand	509	1	1
β-strand	511-515	5	7
β-strand	520-526	7	7
β-strand	533	1	8
β-strand	535-541	7	7
β-strand	544-550	7	7
β-strand	557	1	8
β-strand	558-568	11	1
β-strand	571-580	10	1
β-strand	587-588	2	2
β-strand	591-596	6	1
α-helix	597-598	2

Chain B: 9 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	201-202	2	9
α-helix	203	1
β-strand	204-205	2	10
β-strand	215-225	11	10
β-strand	228-237	10	10
α-helix	243	1
β-strand	244-256	13	10
β-strand	264-271	8	10
α-helix	276-278	3
β-strand	279-287	9	11
β-strand	290-297	8	11
α-helix	310-312	3
β-strand	314-320	7	11
β-strand	332-334	3	11
β-strand	339-341	3	12
β-strand	347-350	4	12
β-strand	354	1	11
β-strand	356-358	3	12
β-strand	361-371	11	12
α-helix	372-374	3
α-helix	379-381	3
α-helix	393-396	4
β-strand	407-417	11	12
α-helix	418-420	3
β-strand	425-430	6	12
β-strand	431	1	13
β-strand	442-447	6	14
β-strand	450-455	6	14
β-strand	465-471	7	14
β-strand	475	1	13
β-strand	476-479	4	14
β-strand	509	1	9
β-strand	511-515	5	15
β-strand	520-526	7	15
β-strand	535-541	7	15
β-strand	544-550	7	15
β-strand	558-568	11	9
β-strand	571-580	10	9
β-strand	587-588	2	10
β-strand	591-596	6	9
α-helix	597-598	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycoprotein G	A, B	protein	453	Henipavirus hendraense	O89343 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8VF1_1 Glycoprotein G (chains A, B)
DRSLHHHHHHGGENLYFQGYRPISQGVSDLVGLPNQICLQKTTSTILKPRLISYTLPINT
REGVCITDPLLAVDNGFFAYSHLEKIGSCTRGIAKQRIIGVGEVLDRGDKVPSMFMTNVW
TPPNPSTIHHCSSTYHEDFYYTLCAVSHVGDPILNSTSWTESLSLIRLAVRPKSDSGDYN
QKYIAITKVERGKYDKVMPYGPSGIKQGDTLYFPAVGFLPRTEFQYNDSNCPIIHCKYSK
AENCRLSMGVNSKSHYILRSGLLKYNLSLGGDIILQFIEIADNRLTIGSPSKIYNSLGQP
VFYQASYSWDTMIKLGDVDTVDPLRVQWRNNSVISRPGQSQCPRFNVCPEVCWEGTYNDA
FLIDRLNWVSAGVYLNSNQTAENPVFAVFKDNEILYQVPLAEDDTNAQKTITDCFLLENV
IWCISLVEIYDTGDSVIRPKLFAVKIPAQCSES

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Nipah and Hendra Viruses Use an Adjustable Latch in Receptor Engagement. von Itzstein, M.S., Winger, M., Malde, A.K. et al. ACS Infect Dis (2025) 11:2729-2738. DOI 10.1021/acsinfecdis.4c01040 · PubMed

Other PDB entries of the same protein (UniProt O89343 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VY4 2.0 Å, Crystal structure of Hendra receptor binding protein head domain in complex with human…
6PD4 2.2 Å, Crystal Structure of Hendra Virus Attachment G Glycoprotein
6VY6 2.6 Å, Crystal structure of Hendra receptor binding protein head domain in complex with human…
6CMG 2.7 Å, Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent…
6PDL 2.7 Å, Crystal Structure of Hendra Virus Attachment G Glycoprotein in Complex with Receptor…
6CMI 2.72 Å, Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent…
7SYY 2.74 Å, Hendra virus G protein head domain in complex with cross-neutralizing murine antibody…
7SYZ 2.86 Å, Hendra virus G protein head domain in complex with cross-neutralizing murine antibody…
2X9M 2.9 Å, Hendra virus attachment glycoprotein
8JR3 3.22 Å, Crystal structure of Hendra Virus attachment(G) glycoprotein mutant S586N in complex…
2VSK 3.3 Å, Hendra virus attachment glycoprotein in complex with human cell surface receptor ephrinB2
8JR5 3.3 Å, Crystal structure of Hendra Virus attachment(G) glycoprotein mutant S586N

Browse structure collections

About this viewer

MolViewer shows 8VF1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.