7T0Q: Human triosephosphate isomerase mutant v154m

Name: PDB 7T0Q: human triosephosphate isomerase mutant v154m
Published: 2022-12-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: isomerase

human triosephosphate isomerase mutant v154m. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Dec 2022.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,181
Mol. weight: 53.6 kDa
Ligands: IPA, PGA
Released: 14 Dec 2022

Explore 7T0Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7T0Q contains 28 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	1
β-strand	14	1	2
α-helix	18-29	12
β-strand	37-42	6	1
α-helix	45-47	3
α-helix	48-54	7
β-strand	60-63	4	1
β-strand	72	1	3
α-helix	80-85	6
β-strand	90-93	4	1
α-helix	96-100	5
α-helix	106-118	13
β-strand	122-127	6	1
α-helix	131-135	5
α-helix	139-152	14
β-strand	160-164	5	1
α-helix	167-169	3
α-helix	178-195	18
α-helix	198-203	6
β-strand	205-208	4	1
α-helix	217-221	5
β-strand	228-231	4	1
α-helix	233-236	4
α-helix	239-244	6

Chain B: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	4
β-strand	14	1	3
α-helix	18-30	13
β-strand	37-42	6	4
α-helix	45-47	3
α-helix	48-54	7
β-strand	59-63	5	4
β-strand	72	1	2
α-helix	80-85	6
β-strand	90-93	4	4
α-helix	96-100	5
α-helix	106-118	13
β-strand	122-127	6	4
α-helix	131-135	5
α-helix	139-152	14
β-strand	160-164	5	4
α-helix	167-169	3
α-helix	178-195	18
α-helix	198-203	6
β-strand	206-208	3	4
α-helix	217-221	5
β-strand	228-231	4	4
α-helix	233-236	4
α-helix	239-244	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Triosephosphate isomerase	A, B	protein	248	Homo sapiens	P60174 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7T0Q_1 Triosephosphate isomerase (chains A, B)
APSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIA
VAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEG
LGVIACIGEKLDEREAGITEKVVFEQTKVIADNMKDWSKVVLAYEPVWAIGTGKTATPQQ
AQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEF
VDIINAKQ

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	1
PGA	2-phosphoglycolic acid	C2 H5 O6 P	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

human triosephosphate isomerase mutant v154m. Romero, J.M. To be published.

Other PDB entries of the same protein (UniProt P60174 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9F69 1.17 Å, Crystal structure of human triose phosphate isomerase with methyl malonic acid ligand
9FFC 1.25 Å, Crystal structure of human triose phosphate isomerase with glycerol-3-phosphate ligand
7RDE 1.31 Å, Human Triose Phosphate Isomerase Q181P
4UNL 1.5 Å, Crystal structure of a single mutant (N71D) of triosephosphate isomerase from human
4POC 1.6 Å, Structure of Triosephosphate Isomerase Wild Type human enzyme.
6UPF 1.65 Å, Triosephosphate isomerase deficiency: Effect of F240L mutation on enzyme structure
4ZVJ 1.7 Å, Structure of human triose phosphate isomerase K13M
2JK2 1.7 Å, Structural basis of human triosephosphate isomerase deficiency. Crystal structure of the…
6UP1 1.83 Å, Triosephosphate isomerase deficiency: Effect of F240L mutation on enzyme structure
2VOM 1.85 Å, Structural basis of human triosephosphate isomerase deficiency. Mutation E104D and…
4BR1 1.9 Å, Protease-induced heterodimer of human triosephosphate isomerase.
6UP5 1.92 Å, Triosephosphate isomerase deficiency: Effect of F240L mutation on enzyme structure

Browse structure collections

About this viewer

MolViewer shows 7T0Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.