7T0W: Gamma-aminobutyric acid receptor subunit beta-2

Complex of GABA-A synaptic receptor with autoimmune antibody Fab115. Determined by electron microscopy at 3.0 Å resolution. Released 13 Jul 2022.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 9
Atoms: 17,427
Mol. weight: 307.35 kDa
Released: 13 Jul 2022

Explore 7T0W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7T0W contains 66 α-helices and 127 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	8-20	13
α-helix	35	1
β-strand	36-51	16	1
β-strand	56-68	13	1
α-helix	70-72	3
β-strand	81-83	3	1
α-helix	85-89	5
β-strand	96-98	3	2
β-strand	101-106	6	1
β-strand	114-118	5	1
β-strand	123-135	13	1
β-strand	147-156	10	2
β-strand	164-168	5	1
β-strand	175-176	2	1
β-strand	188-200	13	2
β-strand	203-215	13	2
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-241	15
α-helix	247-271	25
α-helix	280-305	26
α-helix	310-338	29

Chain B: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
β-strand	39-49	11	3
β-strand	50	1	4
β-strand	53-54	2	3
β-strand	59-71	13	3
α-helix	73-75	3
β-strand	83-86	4	3
α-helix	88-91	4
β-strand	99-101	3	5
β-strand	104-109	6	3
β-strand	113	1	2
β-strand	117-122	6	3
β-strand	126-138	13	3
β-strand	150-159	10	5
β-strand	167-171	5	3
α-helix	175-177	3
β-strand	179-181	3	3
β-strand	186	1	4
β-strand	191-193	3	5
β-strand	198-204	7	5
β-strand	209-221	13	5
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-243	12
α-helix	244-246	3
α-helix	252-274	23
α-helix	285-310	26
α-helix	315-345	31

Chain C: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
α-helix	35	1
β-strand	36-51	16	6
β-strand	56-68	13	6
α-helix	70-72	3
α-helix	80	1
β-strand	81-83	3	6
α-helix	85-89	5
β-strand	96-98	3	7
β-strand	101-106	6	6
β-strand	114-118	5	6
β-strand	123-135	13	6
β-strand	147-156	10	7
β-strand	164-168	5	6
β-strand	175-176	2	6
β-strand	188-200	13	7
β-strand	203-215	13	7
α-helix	216-217	2
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-237	11
α-helix	238-240	3
α-helix	247-271	25
α-helix	280-306	27
α-helix	310-338	29

Chain D: 13 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	13-22	10
β-strand	39	1	8
β-strand	42-49	8	9
β-strand	50	1	10
β-strand	53-54	2	9
β-strand	59-71	13	9
α-helix	73-75	3
β-strand	83-86	4	9
α-helix	88-91	4
β-strand	99-101	3	11
β-strand	104	1	9
β-strand	108-109	2	9
β-strand	117-122	6	9
β-strand	126-138	13	9
α-helix	143-145	3
β-strand	150-159	10	11
β-strand	167	1	8
α-helix	175-177	3
β-strand	179-181	3	9
α-helix	183-185	3
β-strand	186	1	10
β-strand	191-205	15	11
β-strand	208-221	14	11
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-243	12
α-helix	244-246	3
α-helix	252-276	25
α-helix	285-310	26
α-helix	315-346	32

Chain E: 11 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
α-helix	50	1
β-strand	51-56	6	12
β-strand	57-59	3	13
β-strand	61-66	6	12
β-strand	71-83	13	12
α-helix	85-87	3
β-strand	95-98	4	12
α-helix	100-104	5
β-strand	111-112	2	14
β-strand	116-121	6	12
β-strand	130-134	5	12
β-strand	138-150	13	12
β-strand	162-171	10	14
β-strand	179-182	4	12
β-strand	188-190	3	13
β-strand	201-214	14	14
β-strand	219-231	13	14
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-251	10
α-helix	253-256	4
α-helix	262-285	24
α-helix	295-321	27
α-helix	325-355	31

Chain H: 3 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	17
β-strand	6	1	18
α-helix	7-9	3
β-strand	10-11	2	19
β-strand	18-20	3	20
β-strand	22	1	18
β-strand	23	1	21
β-strand	25	1	17
β-strand	33-39	7	22
β-strand	45-49	5	22
β-strand	51	1	23
β-strand	58	1	23
α-helix	62-64	3
β-strand	70	1	20
β-strand	73	1	21
β-strand	78	1	21
β-strand	81-83	3	20
α-helix	88-90	3
β-strand	92	1	19
β-strand	93-99	7	22
β-strand	101-103	3	24
β-strand	108-110	3	24
β-strand	120-121	2	19

Chain H2: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	25
β-strand	10-11	2	26
β-strand	20-25	6	25
β-strand	33-39	7	27
β-strand	45-51	7	27
β-strand	58	1	27
α-helix	62-64	3
β-strand	71-73	3	25
β-strand	78-81	4	25
α-helix	88-90	3
β-strand	93-104	12	27
β-strand	107-112	6	27
β-strand	120-121	2	26

Chain L: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	28
β-strand	5	1	29
β-strand	9-12	4	30
β-strand	18-23	6	29
β-strand	35-39	5	30
β-strand	46-49	4	30
β-strand	50	1	31
β-strand	54	1	31
β-strand	63-68	6	29
β-strand	71-76	6	29
α-helix	81-83	3
β-strand	86-93	8	30
β-strand	99-102	4	30
β-strand	103	1	28
β-strand	106-110	5	30

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit beta-2	A, C	protein	340	Homo sapiens	P47870 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-1	B, D	protein	347	Homo sapiens	P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	E	protein	394	Homo sapiens	P18507 (AlphaFold model)
Fab115 light chain, IgG1	L, L2	protein	217	Homo sapiens
Fab115 Heavy Chain, IgG1	H, H2	protein	246	Homo sapiens

Sequence of entity 1 (A, C), FASTA

>7T0W_1 Gamma-aminobutyric acid receptor subunit beta-2 (chains A, C)
QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT
MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK
IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA
LVNYIFFSQPARAAAIDRWSRIFFPVVFSFFNIVYWLYYV

Sequence of entity 2 (B, D), FASTA

>7T0W_2 Gamma-aminobutyric acid receptor subunit alpha-1 (chains B, D)
QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEY
TIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLR
ITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVV
VAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSA
LIEFATVNYFTKSQPARAAKIDRLSRIAFPLLFGIFNLVYWATYLNR

Sequence of entity 3 (E), FASTA

>7T0W_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains E)
WSHPQFEKGGGSGGGSGGSSAWSHPQFEKLEVLFQGPQKSDDDYEDYASNKTWVLTPKVP
EGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWY
DRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTL
RLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSF
VGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVP
ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSS
QPARAAKMDSYARIFFPTAFCLFNLVYWVSYLYL

Sequence of entity 4 (L, L2), FASTA

>7T0W_4 Fab115 light chain, IgG1 (chains L, L2)
QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVSWYQQLPGTAPKLLIYSTNQRPSGVP
DRFSGSKSGTSASLAIGGLQSEDEADYYCAAWDDSLKRLVVFGGGTRLTVLGQPKAAPSV
TLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAAS
SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Sequence of entity 5 (H, H2), FASTA

>7T0W_5 Fab115 Heavy Chain, IgG1 (chains H, H2)
QVQLVQSGAEVKKPGASVKVSCKASGYTFISYDINWVRQATGQGLEWMGGMDPKSGNTGY
AQKFQGRVTMTTNTAISTAYMELSSLRSEDTAVYYCVRGEQSYDRTGYSDWFDPWGQGTL
VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA
VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHDYKDDDDK
HHHHHH

Primary citation

Structural mechanisms of GABA A receptor autoimmune encephalitis. Noviello, C.M., Kreye, J., Teng, J. et al. Cell (2022) 185:2469. DOI 10.1016/j.cell.2022.06.025 · PubMed

Other PDB entries of the same protein (UniProt P47870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
8SID 2.71 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
8VQY 2.82 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone
6X40 2.86 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin
8DD2 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem
8DD3 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM
9CRS 2.9 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly
6X3X 2.92 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam
9DRX 2.95 Å, Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA…
8SI9 2.98 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…

Browse structure collections

About this viewer

MolViewer shows 7T0W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.