7T0Z: Gamma-aminobutyric acid receptor subunit beta-2

Complex of GABA-A synaptic receptor with autoimmune antibody Fab175. Determined by electron microscopy at 3.0 Å resolution. Released 13 Jul 2022.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 7
Atoms: 15,781
Mol. weight: 258.65 kDa
Ligands: ABU, NAG, MAN
Released: 13 Jul 2022

Explore 7T0Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7T0Z contains 57 α-helices and 91 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	8-20	13
α-helix	35	1
β-strand	36-51	16	1
β-strand	56-68	13	1
β-strand	81-83	3	1
α-helix	85-89	5
β-strand	96-98	3	2
β-strand	101-106	6	1
β-strand	110	1	3
β-strand	114-118	5	1
β-strand	123-135	13	1
β-strand	147-156	10	2
β-strand	164-168	5	1
α-helix	171-173	3
β-strand	175-176	2	1
α-helix	178-180	3
β-strand	186-199	14	2
β-strand	204-216	13	2
α-helix	217	1
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-238	12
α-helix	239-241	3
α-helix	247-271	25
α-helix	280-306	27
α-helix	310-338	29

Chain B: 10 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
β-strand	39-54	16	4
β-strand	59-71	13	4
α-helix	73-75	3
β-strand	83-86	4	4
α-helix	88-91	4
β-strand	99-101	3	5
β-strand	104	1	4
β-strand	108-109	2	4
β-strand	117-122	6	4
β-strand	126-138	13	4
β-strand	150-154	5	5
β-strand	157-159	3	5
β-strand	167-171	5	4
α-helix	175-177	3
β-strand	179-181	3	4
β-strand	186	1	4
β-strand	191-204	14	5
β-strand	209-221	13	5
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-245	14
α-helix	252-276	25
α-helix	285-310	26
α-helix	315-344	30

Chain C: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	8-20	13
α-helix	35	1
β-strand	36-47	12	6
β-strand	51	1	6
β-strand	56-68	13	6
α-helix	70-72	3
β-strand	81-83	3	6
α-helix	85-89	5
β-strand	96-98	3	7
β-strand	101-106	6	6
β-strand	114-118	5	6
β-strand	123-135	13	6
β-strand	147-156	10	7
β-strand	164-168	5	6
α-helix	171-173	3
β-strand	175-176	2	6
β-strand	188-200	13	7
β-strand	203-215	13	7
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-238	12
α-helix	247-271	25
α-helix	280-306	27
α-helix	310-338	29

Chain D: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	13-22	10
β-strand	39-49	11	8
β-strand	53-54	2	8
β-strand	59-71	13	8
α-helix	73-75	3
β-strand	83-86	4	8
α-helix	88-91	4
β-strand	99-101	3	9
β-strand	104	1	8
β-strand	108-109	2	8
β-strand	117-122	6	8
β-strand	126-138	13	8
β-strand	150-151	2	9
β-strand	154-159	6	9
β-strand	167-171	5	8
α-helix	175-177	3
β-strand	179-181	3	8
β-strand	191-205	15	9
β-strand	208-221	14	9
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-243	12
α-helix	244-246	3
α-helix	252-276	25
α-helix	285-310	26
α-helix	315-346	32

Chain E: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	26-34	9
α-helix	50	1
β-strand	51-66	16	10
β-strand	71-83	13	10
α-helix	85-87	3
β-strand	95-98	4	10
β-strand	111-113	3	3
β-strand	116-121	6	10
β-strand	125	1	9
β-strand	129-134	6	10
β-strand	138-150	13	10
β-strand	162-171	10	3
β-strand	179-190	12	10
β-strand	201-214	14	3
β-strand	219-231	13	3
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-255	14
α-helix	262-282	21
α-helix	295-320	26
α-helix	325-356	32

Chain H: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	11
β-strand	12	1	12
β-strand	18-25	8	11
α-helix	29-31	3
β-strand	33-39	7	13
β-strand	45-51	7	13
β-strand	58-60	3	13
β-strand	69-73	5	11
β-strand	78-83	6	11
α-helix	88-90	3
β-strand	92-99	8	13
β-strand	113-114	2	13
β-strand	118-120	3	13
β-strand	122	1	12

Chain L: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	14
β-strand	10-13	4	15
β-strand	18-25	8	14
β-strand	33-38	6	15
β-strand	45-49	5	15
β-strand	53-54	2	15
β-strand	62-67	6	14
β-strand	70-76	7	14
α-helix	80-82	3
β-strand	85-91	7	15
β-strand	97-99	3	15
β-strand	103-107	5	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit beta-2	A, C	protein	340	Homo sapiens	P47870 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-1	B, D	protein	347	Homo sapiens	P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	E	protein	394	Homo sapiens	P18507 (AlphaFold model)
Fab175 IgG1 heavy chain	H	protein	245	Homo sapiens
Fab175 IgG1 light chain	L	protein	215	Homo sapiens

Sequence of entity 1 (A, C), FASTA

>7T0Z_1 Gamma-aminobutyric acid receptor subunit beta-2 (chains A, C)
QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT
MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK
IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA
LVNYIFFSQPARAAAIDRWSRIFFPVVFSFFNIVYWLYYV

Sequence of entity 2 (B, D), FASTA

>7T0Z_2 Gamma-aminobutyric acid receptor subunit alpha-1 (chains B, D)
QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEY
TIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLR
ITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVV
VAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSA
LIEFATVNYFTKSQPARAAKIDRLSRIAFPLLFGIFNLVYWATYLNR

Sequence of entity 3 (E), FASTA

>7T0Z_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains E)
WSHPQFEKGGGSGGGSGGSSAWSHPQFEKLEVLFQGPQKSDDDYEDYASNKTWVLTPKVP
EGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWY
DRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTL
RLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSF
VGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVP
ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSS
QPARAAKMDSYARIFFPTAFCLFNLVYWVSYLYL

Sequence of entity 4 (H), FASTA

>7T0Z_4 Fab175 IgG1 heavy chain (chains H)
EVQLLESGEGLVQPGGSLRLSCAASGFTFKTYAMSWVRQAPGKGLEWVSAISGSGASTYY
ADFVEGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEPPAMVWFGGGYFDYWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHDYKDDDDKH
HHHHH

Sequence of entity 5 (L), FASTA

>7T0Z_5 Fab175 IgG1 light chain (chains L)
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPYSFGQGTKLEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Ligands and cofactors

ID	Name	Formula	Copies
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
MAN	alpha-D-mannopyranose	C6 H12 O6	1

Primary citation

Structural mechanisms of GABA A receptor autoimmune encephalitis. Noviello, C.M., Kreye, J., Teng, J. et al. Cell (2022) 185:2469. DOI 10.1016/j.cell.2022.06.025 · PubMed

Other PDB entries of the same protein (UniProt P47870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
8SID 2.71 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
8VQY 2.82 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone
6X40 2.86 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin
8DD2 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem
8DD3 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM
9CRS 2.9 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly
6X3X 2.92 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam
9DRX 2.95 Å, Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA…
8SI9 2.98 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…

Browse structure collections

About this viewer

MolViewer shows 7T0Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.