Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-588. Determined by X-ray diffraction at 1.89 Å resolution. Released 19 Jan 2022.
Explore 7T2I in 3D Show helices and sheets RCSB PDB PDBe
7T2I contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1381-1397 | 17 | |
| α-helix | 1403-1405 | 3 | |
| α-helix | 1417-1420 | 4 | |
| α-helix | 1427-1435 | 9 | |
| α-helix | 1442-1459 | 18 | |
| α-helix | 1465-1483 | 19 | |
| α-helix | 1485-1495 | 11 | |
| α-helix | 1497-1500 | 4 | |
| α-helix | 1502-1513 | 12 | |
| α-helix | 1514-1519 | 6 | |
| α-helix | 1526-1528 | 3 | |
| α-helix | 1540-1543 | 4 | |
| α-helix | 1550-1558 | 9 | |
| α-helix | 1565-1583 | 19 | |
| α-helix | 1588-1606 | 19 | |
| α-helix | 1608-1624 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcription initiation factor TFIID subunit 1 | A | protein | 265 | Homo sapiens | P21675 (AlphaFold model) |
>7T2I_1 Transcription initiation factor TFIID subunit 1 (chains A) SMSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTL RENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLAR LEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDL ETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEH LTQLEKDICTAKEAALEEAELESLD
| ID | Name | Formula | Copies |
|---|---|---|---|
| E9F | 4-(6-{1-[(R)-S-methanesulfonimidoyl]cyclopropyl}-2-[(3R)-3-methylmorpholin-4-yl… | C20 H24 N6 O2 S | 1 |
Water and common crystallization additives (EDO, DMS) are not listed.
Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-588. Karim, M.R., Schonbrunn, E. To be published.
Other PDB entries of the same protein (UniProt P21675 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7T2I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.