7TNK: Complex GNNN of AMPA-subtype iGluR GluA2

Complex GNNN of AMPA-subtype iGluR GluA2 in complex with auxiliary subunit gamma2 (Stargazin) at low glutamate concentration (20 uM) in the presence of cyclothiazide (100 uM). Determined by electron microscopy at 4.5 Å resolution. Released 20 Apr 2022.

Method: Electron microscopy
Resolution: 4.5 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 18,934
Mol. weight: 463.49 kDa
Ligands: CYZ, GLU
Released: 20 Apr 2022

Explore 7TNK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TNK contains 100 α-helices and 111 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	397-399	3	1
β-strand	402	1	2
β-strand	406-408	3	2
β-strand	421-423	3	2
α-helix	424-436	13
β-strand	442-444	3	1
β-strand	453	1	3
β-strand	460	1	3
α-helix	462-468	7
β-strand	474-475	2	1
β-strand	480	1	4
α-helix	483-486	4
β-strand	489-490	2	5
β-strand	496-498	3	4
β-strand	500-505	6	6
α-helix	510-513	4
α-helix	516-518	3
β-strand	521	1	7
α-helix	523-544	22
α-helix	566-568	3
α-helix	573-584	12
α-helix	596-624	29
α-helix	636-641	6
β-strand	646-648	3	6
β-strand	650	1	8
α-helix	654-660	7
α-helix	665-675	11
β-strand	683	1	8
α-helix	686-694	9
β-strand	700-705	6	6
α-helix	706-712	7
β-strand	720-723	4	6
β-strand	730-732	3	4
β-strand	735	1	1
β-strand	736-737	2	5
α-helix	743-755	13
α-helix	758-764	7
α-helix	765-769	5
α-helix	786	1
β-strand	787	1	9
α-helix	788	1
α-helix	789-791	3
α-helix	793-819	27
α-helix	1005-1028	24
β-strand	1033-1034	2	10
β-strand	1038	1	11
β-strand	1055	1	11
β-strand	1058-1059	2	12
β-strand	1060	1	10
β-strand	1064-1067	4	12
β-strand	1076-1078	3	12
α-helix	1095-1102	8
α-helix	1105-1125	21
α-helix	1133-1157	25
β-strand	1174-1175	2	10
α-helix	1179-1205	27

Chain B: 26 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	397-399	3	13
β-strand	406-408	3	14
α-helix	417-420	4
β-strand	421-423	3	14
α-helix	425-436	12
β-strand	442-444	3	13
α-helix	462-469	8
β-strand	474-475	2	13
β-strand	480	1	15
α-helix	483-486	4
β-strand	490-491	2	13
β-strand	496-498	3	15
β-strand	500-505	6	16
β-strand	521	1	17
α-helix	523-545	23
α-helix	573-584	12
α-helix	596-625	30
α-helix	628-631	4
β-strand	646-648	3	16
β-strand	650	1	18
α-helix	654-660	7
α-helix	665-674	10
β-strand	683	1	18
α-helix	686-695	10
β-strand	700-705	6	16
α-helix	706-713	8
β-strand	720-723	4	16
β-strand	730-732	3	15
β-strand	735-736	2	13
α-helix	743-755	13
α-helix	758-764	7
α-helix	765-769	5
α-helix	786	1
β-strand	787	1	7
α-helix	788	1
α-helix	793-819	27
α-helix	1007-1028	22
β-strand	1033-1036	4	19
β-strand	1057-1060	4	19
β-strand	1065-1066	2	20
β-strand	1076-1077	2	20
α-helix	1085-1088	4
α-helix	1092-1102	11
α-helix	1105-1126	22
α-helix	1133-1160	28
β-strand	1174-1175	2	19
α-helix	1179-1191	13
α-helix	1193-1203	11
α-helix	1205-1208	4

Chain C: 23 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	395-398	4	21
β-strand	402	1	22
β-strand	406	1	22
β-strand	407-408	2	23
α-helix	417-419	3
β-strand	421-422	2	23
α-helix	424-436	13
β-strand	440-442	3	21
β-strand	452-454	3	24
β-strand	459-461	3	24
α-helix	462-468	7
β-strand	474-475	2	21
β-strand	480	1	25
α-helix	483-488	6
β-strand	489	1	26
β-strand	496-498	3	25
β-strand	500-505	6	27
α-helix	506-507	2
β-strand	521	1	28
α-helix	523-543	21
α-helix	566-568	3
α-helix	573-584	12
α-helix	597-629	33
α-helix	637-640	4
β-strand	646-649	4	27
β-strand	650	1	29
α-helix	654-660	7
α-helix	665-675	11
β-strand	683	1	29
α-helix	686-694	9
β-strand	700-705	6	27
α-helix	706-712	7
β-strand	720-723	4	27
β-strand	730-732	3	25
β-strand	735	1	21
β-strand	737	1	26
α-helix	743-756	14
α-helix	758-766	9
α-helix	774	1
β-strand	787	1	17
α-helix	793-819	27
α-helix	1006-1027	22
β-strand	1033	1	30
β-strand	1034	1	31
β-strand	1036	1	32
β-strand	1057	1	32
β-strand	1058-1059	2	33
β-strand	1060	1	30
β-strand	1064	1	34
β-strand	1066-1067	2	33
β-strand	1078	1	34
α-helix	1094-1102	9
α-helix	1106-1122	17
α-helix	1133-1157	25
β-strand	1174	1	31
α-helix	1180-1207	28

Chain D: 25 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	396-399	4	35
β-strand	407-408	2	36
α-helix	417-419	3
β-strand	421-422	2	36
α-helix	424-435	12
β-strand	441-444	4	35
β-strand	452-454	3	37
β-strand	459-461	3	37
α-helix	463-468	6
β-strand	474-475	2	35
β-strand	480	1	38
α-helix	483-486	4
β-strand	489-491	3	35
β-strand	496-498	3	38
β-strand	500-505	6	39
α-helix	506-508	3
β-strand	521	1	9
α-helix	523-544	22
α-helix	573-584	12
α-helix	596-625	30
α-helix	636-639	4
β-strand	646-648	3	39
β-strand	650	1	40
α-helix	654-661	8
α-helix	665-676	12
β-strand	683	1	40
α-helix	686-694	9
β-strand	700-705	6	39
α-helix	706-714	9
β-strand	720-722	3	39
β-strand	730-732	3	38
β-strand	735-737	3	35
α-helix	743-755	13
α-helix	758-764	7
α-helix	765-769	5
α-helix	786	1
β-strand	787	1	28
α-helix	788	1
α-helix	793-818	26
α-helix	1007-1027	21
β-strand	1033-1036	4	41
β-strand	1057-1060	4	41
β-strand	1065	1	42
β-strand	1077	1	42
α-helix	1085-1088	4
α-helix	1094-1102	9
α-helix	1105-1122	18
α-helix	1133-1160	28
β-strand	1174-1175	2	41
α-helix	1177-1208	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform Flip of Glutamate receptor 2,Voltage-dependent calcium channel gamma-3 subunit chimera	A, B, C, D	protein	1033	Rattus norvegicus	P19491 (AlphaFold model), Q8VHX0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7TNK_1 Isoform Flip of Glutamate receptor 2,Voltage-dependent calcium channel gamma-3 subunit chimera (chains A, B, C, D)
NSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRG
VYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQ
WDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQDLELKKE
RRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGAEVSGFQIVD
YDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRR
GNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPR
KIGYWSEVDKMVLTEDDTSGLEQKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLA
AEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVI
DFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPY
EWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT
LIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDK
MWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS
KGYGIATPKGSSLGTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKEKTSALSL
SNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKGTGLFDRGVQMLLTTVGAFAAFS
LMTIAVGTDYWLYSRGVCKTKSVSEDETSKKNEEVMTHSGLWRTCCLEGNFKGLCKQIDH
FPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGIFF
VSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFI
DRHKQLTGGLVPR

Ligands and cofactors

ID	Name	Formula	Copies
CYZ	Cyclothiazide	C14 H16 Cl N3 O4 S2	4
GLU	Glutamic acid	C5 H9 N O4	1

Primary citation

Opening of glutamate receptor channel to subconductance levels. Yelshanskaya, M.V., Patel, D.S., Kottke, C.M. et al. Nature (2022) 605:172-178. DOI 10.1038/s41586-022-04637-w · PubMed

Other PDB entries of the same protein (UniProt P19491 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YK4 1.0 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
5NG9 1.15 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with agonist…
6YK5 1.15 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
6YK3 1.2 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
5JEI 1.23 Å, Crystal structure of the GluA2 LBD in complex with FW
4IGT 1.24 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the agonist…
4YU0 1.26 Å, Crystal structure of a tetramer of GluA2 TR mutant ligand binding domains bound with…
5NIH 1.3 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with agonist…
1MQI 1.35 Å, Crystal Structure of the GluR2 Ligand Binding Core (S1S2J) in Complex with…
5FTI 1.35 Å, Crystal structure of the GluA2 K738M-T744K LBD in complex with glutamate (lithium form)
4U21 1.39 Å, GluA2flip sLBD complexed with FW and (R,R)-2b crystal form E
4FAT 1.4 Å, Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an…

Browse structure collections

About this viewer

MolViewer shows 7TNK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.