7TPB: P120RasGAP SH3 domain

p120RasGAP SH3 domain in complex with DLC1 RhoGAP domain. Determined by X-ray diffraction at 3.2 Å resolution. Released 3 Aug 2022.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 8
Atoms: 8,096
Mol. weight: 134.65 kDa
Released: 3 Aug 2022

Explore 7TPB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TPB contains 56 α-helices and 32 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C, E and G: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	283-286	4	1
β-strand	290	1	2
α-helix	292-293	2
β-strand	298	1	1
β-strand	301	1	2
β-strand	306-312	7	1
α-helix	314-316	3
β-strand	317-322	6	1
β-strand	327-332	6	1
α-helix	333-335	3
β-strand	336-338	3	1

Chains B, D, F and H: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	1080-1087	8
α-helix	1093-1105	13
α-helix	1119-1129	11
α-helix	1143-1155	13
α-helix	1164-1176	13
α-helix	1179-1181	3
α-helix	1182-1191	10
α-helix	1195-1212	18
α-helix	1215-1218	4
α-helix	1222-1234	13
α-helix	1260-1278	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras GTPase-activating protein 1	A, C, E, G	protein	66	Homo sapiens	B4DTL8 (AlphaFold model)
Rho GTPase-activating protein 7	B, D, F, H	protein	228	Homo sapiens	Q96QB1 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>7TPB_1 Ras GTPase-activating protein 1 (chains A, C, E, G)
GPLGSRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDL
VEEVGR

Sequence of entity 2 (B, D, F, H), FASTA

>7TPB_2 Rho GTPase-activating protein 7 (chains B, D, F, H)
MHHHHHHSSGRENLYFQGSVFGVPLTVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRK
SGVKSRIQALRQMNEGAIDCVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQ
YVPKDQRLQAIKAAIMLLPDENREVLQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFH
LNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGLAHMIAECKKL

Primary citation

SH3 domain regulation of RhoGAP activity: Crosstalk between p120RasGAP and DLC1 RhoGAP. Chau, J.E., Vish, K.J., Boggon, T.J. et al. Nat Commun (2022) 13:4788-4788. DOI 10.1038/s41467-022-32541-4 · PubMed

Browse structure collections

About this viewer

MolViewer shows 7TPB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.