7TQS: Coxsackievirus A21 capsid subdomain

Coxsackievirus A21 capsid subdomain in complex with mouse polyclonal antibody pAbC-3. Determined by electron microscopy at 3.9 Å resolution. Released 4 Jan 2023.

Method: Electron microscopy
Resolution: 3.9 Å
Organisms: Mus musculus, Coxsackievirus A21
Chains: 22
Atoms: 34,113
Mol. weight: 504.33 kDa
Ligands: MYR
Released: 4 Jan 2023

Explore 7TQS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TQS contains 215 α-helices and 373 β-strands across 22 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 14 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
α-helix	23-24	2
β-strand	25	1	6
β-strand	39-40	2	7
α-helix	46-48	3
α-helix	52-55	4
β-strand	58	1	8
β-strand	61	1	6
α-helix	68-70	3
β-strand	71	1	9
α-helix	72-75	4
β-strand	80-83	4	10
β-strand	87-89	3	10
α-helix	94-97	4
β-strand	100-104	5	11
α-helix	111-117	7
β-strand	120	1	12
β-strand	122-136	15	10
α-helix	146-148	3
β-strand	149-155	7	11
α-helix	168-171	4
β-strand	177-181	5	11
β-strand	182	1	13
β-strand	184	1	13
α-helix	185-187	3
β-strand	188-191	4	10
β-strand	200-201	2	10
β-strand	206	1	14
β-strand	207	1	15
β-strand	212	1	16
β-strand	213	1	17
β-strand	215	1	17
β-strand	224	1	15
α-helix	226-228	3
β-strand	234-239	6	11
β-strand	248-263	16	10
β-strand	266	1	12
α-helix	268-269	2
β-strand	270	1	18
α-helix	283-285	3
β-strand	292	1	19

Chain b: 12 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	20
β-strand	21-25	5	20
β-strand	32-33	2	21
α-helix	34-36	3
α-helix	41-43	3
α-helix	44-46	3
β-strand	51	1	22
α-helix	52-53	2
β-strand	54	1	21
α-helix	57-59	3
β-strand	64-65	2	21
α-helix	66-68	3
β-strand	69-71	3	23
β-strand	78-81	4	24
α-helix	82-85	4
α-helix	90-98	9
β-strand	99-111	13	21
β-strand	118-128	11	24
β-strand	134	1	25
α-helix	145-148	4
β-strand	155-156	2	24
β-strand	158	1	26
α-helix	163-165	3
β-strand	174	1	25
β-strand	177	1	26
β-strand	185	1	18
α-helix	187-192	6
β-strand	195-199	5	24
β-strand	205-210	6	21
β-strand	219	1	21
β-strand	224	1	14
β-strand	227-239	13	24
β-strand	247-249	3	23
β-strand	250-263	14	21
α-helix	266-267	2
β-strand	269	1	16

Chain c: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	27
α-helix	7	1
β-strand	13-14	2	28
β-strand	23	1	10
α-helix	30-33	4
β-strand	40	1	10
β-strand	42	1	9
α-helix	44-47	4
β-strand	51-52	2	7
β-strand	58	1	19
α-helix	65-68	4
β-strand	70-73	4	7
β-strand	82-85	4	29
α-helix	94-96	3
α-helix	98-103	6
β-strand	106	1	30
β-strand	108-110	3	31
β-strand	113-119	7	7
β-strand	126	1	32
β-strand	128-134	7	29
α-helix	144-147	4
β-strand	151-156	6	29
β-strand	162-167	6	7
β-strand	176-177	2	31
α-helix	182-184	3
β-strand	188-193	6	29
α-helix	196-197	2
β-strand	198	1	32
β-strand	206-215	10	7
β-strand	220-221	2	31
β-strand	224	1	30
α-helix	233-235	3

Chains d, p and t: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	33
α-helix	8	1
β-strand	9	1	34
α-helix	10	1
β-strand	26-29	4	33
β-strand	35	1	35
α-helix	36-38	3
α-helix	40-44	5
α-helix	51-54	4
β-strand	57	1	21

Chain e: 17 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
α-helix	23-24	2
β-strand	25	1	36
α-helix	26-27	2
β-strand	28	1	22
β-strand	39-40	2	37
α-helix	52-55	4
β-strand	58	1	22
β-strand	61	1	36
β-strand	71	1	38
α-helix	72-75	4
α-helix	79	1
β-strand	80-89	10	39
α-helix	93-99	7
β-strand	100-104	5	40
α-helix	111-117	7
β-strand	120-136	17	39
α-helix	146-148	3
β-strand	149-155	7	40
α-helix	160-162	3
α-helix	168-171	4
β-strand	177-181	5	40
α-helix	186-187	2
β-strand	188-191	4	39
β-strand	200-201	2	39
β-strand	206	1	41
β-strand	207	1	42
β-strand	224	1	42
α-helix	226-229	4
β-strand	234-239	6	40
α-helix	242-243	2
β-strand	248-266	19	39
α-helix	268-270	3
α-helix	283-285	3
α-helix	289-291	3
β-strand	292	1	43

Chain f: 13 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	44
β-strand	21-25	5	44
β-strand	28	1	45
α-helix	29-31	3
β-strand	32-33	2	45
α-helix	34-36	3
α-helix	41-43	3
α-helix	44-46	3
β-strand	51	1	46
α-helix	52-53	2
β-strand	54	1	45
α-helix	57-59	3
β-strand	64-65	2	45
α-helix	66-68	3
β-strand	69-72	4	47
β-strand	78-81	4	48
α-helix	82-85	4
α-helix	92-98	7
β-strand	99-111	13	45
β-strand	119-128	10	48
β-strand	134	1	49
α-helix	151-153	3
β-strand	155-156	2	48
β-strand	158	1	50
α-helix	169-171	3
β-strand	174	1	49
β-strand	177	1	50
α-helix	187-192	6
β-strand	195-199	5	48
β-strand	205-210	6	45
β-strand	219	1	45
β-strand	224	1	41
β-strand	227-238	12	48
β-strand	246-249	4	47
β-strand	250-263	14	45
α-helix	266-267	2

Chain g: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	27
α-helix	7	1
β-strand	13-14	2	11
β-strand	23	1	39
α-helix	30-33	4
β-strand	39-40	2	39
β-strand	42	1	38
α-helix	44-47	4
β-strand	51-52	2	37
β-strand	58	1	43
α-helix	65-68	4
β-strand	70-73	4	37
β-strand	80-85	6	51
α-helix	94-96	3
α-helix	98-103	6
β-strand	106	1	52
β-strand	108-109	2	53
β-strand	110	1	54
β-strand	113-119	7	37
β-strand	126	1	55
β-strand	128-134	7	51
α-helix	144-147	4
β-strand	151-156	6	51
β-strand	162-167	6	37
β-strand	176-177	2	53
β-strand	188-193	6	51
α-helix	196-197	2
β-strand	198	1	55
β-strand	206-215	10	37
β-strand	220	1	54
β-strand	224	1	52
α-helix	233-235	3

Chain h: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	56
α-helix	8	1
β-strand	9	1	35
α-helix	10	1
β-strand	26-29	4	56
β-strand	35	1	57
α-helix	36-38	3
α-helix	40-44	5
α-helix	51-54	4
α-helix	60-62	3

12 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
pAbC-3 light chain	L	protein	96	Mus musculus
pAbC-3 heavy chain	H	protein	106	Mus musculus
VP1	a, e, i, m, q	protein	298	Coxsackievirus A21	Q7T7N6 (AlphaFold model)
VP2	b, f, j, n, r	protein	272	Coxsackievirus A21	P22055
VP3	c, g, k, o, s	protein	240	Coxsackievirus A21	P22055
VP4	d, h, l, p, t	protein	69	Coxsackievirus A21	P22055

Sequence of entity 1 (L), FASTA

>7TQS_1 pAbC-3 light chain (chains L)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Sequence of entity 2 (H), FASTA

>7TQS_2 pAbC-3 heavy chain (chains H)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Sequence of entity 3 (a, e, i, m, q), FASTA

>7TQS_3 VP1 (chains a, e, i, m, q)
GIEDLIDTAIKNALRVSQPPSTQSTEATSGVNSQEVPALTAVETGASGQAIPSDVVETRH
VVNYKTRSESCLESFFGRAACVTILSLTNSSKSGEEKKHFNIWNITYTDTVQLRRKLEFF
TYSRFDLEMTFVFTENYPSTASGEVRNQVYQIMYIPPGAPRPSSWDDYTWQSSSNPSIFY
MYGNAPPRMSIPYVGIANAYSHFYDGFARVPLEGENTDAGDTFYGLVSINDFGVLAVRAV
NRSNPHTIHTSVRVYMKPKHIRCWCPRPPRAVLYRGEGVDMISSAILPLAKVDSITTF

Sequence of entity 4 (b, f, j, n, r), FASTA

>7TQS_4 VP2 (chains b, f, j, n, r)
SPNVEACGYSDRVRQITLGNSTITTQEAANAIVAYGEWPTYINDSEANPVDAPTEPDVSS
NRFYTLESVSWKTTSRGWWWKLPDCLKDMGMFGQNMYYHYLGRSGYTIHVQCNASKFHQG
ALGVFLIPEFVMACNTESKTSYVSYINANPGERGGEFTNTYNPSNTDASEGRKFAALDYL
LGSGVLAGNAFVYPHQIINLRTNNSATIVVPYVNSLVIDCMAKHNNWGIVILPLAPLAFA
ATSSPQVPITVTIAPMCTEFNGLRNITVPVHQ

Sequence of entity 5 (c, g, k, o, s), FASTA

>7TQS_5 VP3 (chains c, g, k, o, s)
GLPTMNTPGSNQFLTSDDFQSPCALPNFDVTPPIHIPGEVKNMMELAEIDTLIPMNAVDG
KVNTMEMYQIPLNDNLSKAPIFCLSLSPASDKRLSHTMLGEILNYYTHWTGSIRFTFLFC
GSMMATGKLLLSYSPPGAKPPTNRKDAMLGTHIIWDLGLQSSCSMVAPWISNTVYRRCAR
DDFTEGGFITCFYQTRIVVPASTPTSMFMLGFVSACPDFSVRLLRDTPHISQSKLIGRTQ

Sequence of entity 6 (d, h, l, p, t), FASTA

>7TQS_6 VP4 (chains d, h, l, p, t)
MGAQVSTQKTGAHENQNVAANGSTINYTTINYYKDSASNSATRQDLSQDPSKFTEPVKDL
MLKTAPALN

Ligands and cofactors

ID	Name	Formula	Copies
MYR	Myristic acid	C14 H28 O2	5

Primary citation

High-resolution structural analysis of enterovirus-reactive polyclonal antibodies in complex with whole virions. Antanasijevic, A., Schulze, A.J., Reddy, V.S. et al. PNAS Nexus (2022) 1:pgac253-pgac253. DOI 10.1093/pnasnexus/pgac253 · PubMed

Other PDB entries of the same protein (UniProt Q7T7N6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7TQU 3.8 Å, Coxsackievirus A21 capsid subdomain in complex with mouse polyclonal antibody pAbC-1
7TQT 4.1 Å, Coxsackievirus A21 capsid subdomain in complex with mouse polyclonal antibody pAbC-5
1Z7Z 8.0 Å, Cryo-em structure of human coxsackievirus A21 complexed with five domain icam-1kilifi

Browse structure collections

About this viewer

MolViewer shows 7TQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.