7TQU: Coxsackievirus A21 capsid subdomain

Coxsackievirus A21 capsid subdomain in complex with mouse polyclonal antibody pAbC-1. Determined by electron microscopy at 3.8 Å resolution. Released 4 Jan 2023.

Method: Electron microscopy
Resolution: 3.8 Å
Organisms: Mus musculus, Coxsackievirus A21
Chains: 14
Atoms: 20,891
Mol. weight: 310.51 kDa
Ligands: MYR
Released: 4 Jan 2023

Explore 7TQU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TQU contains 113 α-helices and 230 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 15 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	17-24	8
β-strand	25	1	11
β-strand	28	1	12
β-strand	31	1	13
β-strand	39-40	2	14
α-helix	46-48	3
α-helix	52-54	3
β-strand	58	1	12
β-strand	61	1	11
β-strand	71	1	15
α-helix	72-76	5
β-strand	80-89	10	16
α-helix	93-98	6
β-strand	100-104	5	17
α-helix	111-117	7
β-strand	120-136	17	16
α-helix	146-148	3
β-strand	149-155	7	17
α-helix	168-171	4
β-strand	177-181	5	17
α-helix	186-187	2
β-strand	188-191	4	16
β-strand	200-201	2	16
β-strand	206	1	18
β-strand	207	1	19
β-strand	212	1	20
β-strand	224	1	19
α-helix	226-228	3
β-strand	234-239	6	17
α-helix	242-243	2
β-strand	248-266	19	16
α-helix	268-270	3
α-helix	280-282	3
α-helix	283-285	3
α-helix	290-291	2
β-strand	292	1	21

Chain b: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	22
β-strand	21-25	5	22
β-strand	28	1	23
β-strand	32-33	2	23
α-helix	34-36	3
α-helix	41-43	3
α-helix	52-53	2
β-strand	54	1	23
β-strand	64-65	2	23
α-helix	66-68	3
β-strand	69-71	3	24
β-strand	78-81	4	25
α-helix	82-85	4
α-helix	90-98	9
β-strand	99-111	13	23
β-strand	118-128	11	25
β-strand	134	1	26
β-strand	136	1	27
α-helix	151-153	3
β-strand	155-156	2	25
β-strand	158	1	28
β-strand	164	1	27
β-strand	174	1	26
β-strand	177	1	28
α-helix	187-192	6
β-strand	195-199	5	25
β-strand	205-210	6	23
β-strand	219	1	23
β-strand	224	1	18
β-strand	227-239	13	25
β-strand	242	1	25
β-strand	247-249	3	24
β-strand	250-263	14	23
α-helix	266-267	2
β-strand	269	1	20

Chain c: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	23	1	16
α-helix	30-33	4
β-strand	39-40	2	16
β-strand	42	1	15
α-helix	44-47	4
β-strand	51-52	2	14
β-strand	58	1	21
α-helix	65-68	4
β-strand	70-73	4	14
β-strand	80-85	6	13
α-helix	94-96	3
α-helix	98-103	6
β-strand	106	1	29
β-strand	108-110	3	30
β-strand	113-119	7	14
β-strand	126-134	9	13
α-helix	144-148	5
β-strand	151-156	6	13
β-strand	162-167	6	14
β-strand	176-177	2	30
α-helix	182-184	3
β-strand	188-198	11	13
β-strand	206-215	10	14
β-strand	220-221	2	30
β-strand	224	1	29

Chain d: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	31
α-helix	8-10	3
β-strand	26-29	4	31
α-helix	36-38	3
α-helix	41-44	4
α-helix	51-54	4
β-strand	57	1	23

Chain e: 15 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	18-24	7
β-strand	25	1	32
β-strand	31-33	3	33
β-strand	39-40	2	34
α-helix	42-44	3
α-helix	46-48	3
α-helix	52-54	3
β-strand	61	1	32
β-strand	71	1	35
α-helix	72-75	4
β-strand	80-89	10	36
α-helix	93-98	6
β-strand	100-104	5	37
α-helix	111-117	7
β-strand	120	1	38
β-strand	122-136	15	36
α-helix	146-148	3
β-strand	149-155	7	37
α-helix	168-171	4
β-strand	177-181	5	37
α-helix	185-187	3
β-strand	188-191	4	36
β-strand	200-201	2	36
β-strand	206	1	39
β-strand	207	1	40
β-strand	212	1	41
β-strand	224	1	40
α-helix	226-229	4
β-strand	234-239	6	37
α-helix	242-243	2
β-strand	248-263	16	36
β-strand	266	1	38
α-helix	268-270	3
α-helix	283-285	3
α-helix	290-291	2

Chain f: 12 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	13
β-strand	21-25	5	13
β-strand	28	1	42
β-strand	32-33	2	42
α-helix	34-36	3
α-helix	41-43	3
α-helix	44-46	3
α-helix	52-53	2
β-strand	54	1	42
β-strand	64-65	2	42
α-helix	66-68	3
β-strand	69-72	4	43
β-strand	78-81	4	44
α-helix	82-85	4
α-helix	90-98	9
β-strand	99-111	13	42
β-strand	119-128	10	44
β-strand	134	1	45
α-helix	145-148	4
α-helix	151-153	3
β-strand	155-156	2	44
β-strand	158	1	46
α-helix	168-171	4
β-strand	174	1	45
β-strand	177	1	46
α-helix	187-192	6
β-strand	195-199	5	44
β-strand	205-210	6	42
β-strand	219	1	42
β-strand	224	1	39
β-strand	227-238	12	44
β-strand	246-249	4	43
β-strand	250-263	14	42
α-helix	266-267	2
β-strand	269	1	41

Chain g: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	23	1	36
α-helix	30-33	4
β-strand	40	1	36
β-strand	42	1	35
α-helix	44-47	4
β-strand	51-52	2	34
α-helix	65-68	4
β-strand	70-73	4	34
β-strand	77	1	10
β-strand	82-85	4	33
α-helix	98-103	6
β-strand	106	1	47
β-strand	108-110	3	48
β-strand	113-119	7	34
β-strand	126	1	49
β-strand	127-134	8	33
α-helix	144-147	4
β-strand	151-157	7	33
β-strand	162-167	6	34
β-strand	176-177	2	48
β-strand	188-193	6	33
β-strand	198	1	49
β-strand	206-215	10	34
β-strand	220-221	2	48
β-strand	224	1	47

Chain h: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	50
α-helix	8-10	3
β-strand	26-29	4	50
α-helix	36-38	3
α-helix	40-41	2
α-helix	51-54	4
β-strand	57	1	42

6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
pAbC-1 heavy chain	H	protein	112	Mus musculus
pAbC-1 light chain	L	protein	102	Mus musculus
VP1	a, e, i	protein	298	Coxsackievirus A21	Q7T7N6 (AlphaFold model)
VP2	b, f, j	protein	272	Coxsackievirus A21	P22055
VP3	c, g, k	protein	240	Coxsackievirus A21	P22055
VP4	d, h, l	protein	69	Coxsackievirus A21	P22055

Sequence of entity 1 (H), FASTA

>7TQU_1 pAbC-1 heavy chain (chains H)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Sequence of entity 2 (L), FASTA

>7TQU_2 pAbC-1 light chain (chains L)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Sequence of entity 3 (a, e, i), FASTA

>7TQU_3 VP1 (chains a, e, i)
GIEDLIDTAIKNALRVSQPPSTQSTEATSGVNSQEVPALTAVETGASGQAIPSDVVETRH
VVNYKTRSESCLESFFGRAACVTILSLTNSSKSGEEKKHFNIWNITYTDTVQLRRKLEFF
TYSRFDLEMTFVFTENYPSTASGEVRNQVYQIMYIPPGAPRPSSWDDYTWQSSSNPSIFY
MYGNAPPRMSIPYVGIANAYSHFYDGFARVPLEGENTDAGDTFYGLVSINDFGVLAVRAV
NRSNPHTIHTSVRVYMKPKHIRCWCPRPPRAVLYRGEGVDMISSAILPLAKVDSITTF

Sequence of entity 4 (b, f, j), FASTA

>7TQU_4 VP2 (chains b, f, j)
SPNVEACGYSDRVRQITLGNSTITTQEAANAIVAYGEWPTYINDSEANPVDAPTEPDVSS
NRFYTLESVSWKTTSRGWWWKLPDCLKDMGMFGQNMYYHYLGRSGYTIHVQCNASKFHQG
ALGVFLIPEFVMACNTESKTSYVSYINANPGERGGEFTNTYNPSNTDASEGRKFAALDYL
LGSGVLAGNAFVYPHQIINLRTNNSATIVVPYVNSLVIDCMAKHNNWGIVILPLAPLAFA
ATSSPQVPITVTIAPMCTEFNGLRNITVPVHQ

Sequence of entity 5 (c, g, k), FASTA

>7TQU_5 VP3 (chains c, g, k)
GLPTMNTPGSNQFLTSDDFQSPCALPNFDVTPPIHIPGEVKNMMELAEIDTLIPMNAVDG
KVNTMEMYQIPLNDNLSKAPIFCLSLSPASDKRLSHTMLGEILNYYTHWTGSIRFTFLFC
GSMMATGKLLLSYSPPGAKPPTNRKDAMLGTHIIWDLGLQSSCSMVAPWISNTVYRRCAR
DDFTEGGFITCFYQTRIVVPASTPTSMFMLGFVSACPDFSVRLLRDTPHISQSKLIGRTQ

Sequence of entity 6 (d, h, l), FASTA

>7TQU_6 VP4 (chains d, h, l)
MGAQVSTQKTGAHENQNVAANGSTINYTTINYYKDSASNSATRQDLSQDPSKFTEPVKDL
MLKTAPALN

Ligands and cofactors

ID	Name	Formula	Copies
MYR	Myristic acid	C14 H28 O2	3

Primary citation

High-resolution structural analysis of enterovirus-reactive polyclonal antibodies in complex with whole virions. Antanasijevic, A., Schulze, A.J., Reddy, V.S. et al. PNAS Nexus (2022) 1:pgac253-pgac253. DOI 10.1093/pnasnexus/pgac253 · PubMed

Other PDB entries of the same protein (UniProt Q7T7N6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7TQS 3.9 Å, Coxsackievirus A21 capsid subdomain in complex with mouse polyclonal antibody pAbC-3
7TQT 4.1 Å, Coxsackievirus A21 capsid subdomain in complex with mouse polyclonal antibody pAbC-5
1Z7Z 8.0 Å, Cryo-em structure of human coxsackievirus A21 complexed with five domain icam-1kilifi

Browse structure collections

About this viewer

MolViewer shows 7TQU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.