7TZE: Murine LAG3 domains 1-2

Structure of murine LAG3 domains 1-2. Determined by X-ray diffraction at 2.12 Å resolution. Released 11 May 2022.

Method: X-ray diffraction
Resolution: 2.12 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,372
Mol. weight: 52.32 kDa
Ligands: NAG
Released: 11 May 2022

Explore 7TZE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TZE contains 14 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	29-30	2
β-strand	31-35	5	1
β-strand	40-42	3	2
β-strand	45	1	3
α-helix	53-56	4
β-strand	60-67	8	1
β-strand	95-100	6	1
β-strand	116-117	2	2
α-helix	120-124	5
β-strand	127	1	3
β-strand	130-132	3	2
α-helix	137-139	3
β-strand	141-148	8	1
β-strand	153-163	11	1
β-strand	165-170	6	4
β-strand	175	1	5
β-strand	181-187	7	4
α-helix	192-193	2
β-strand	195-200	6	6
β-strand	205-207	3	6
β-strand	210	1	7
β-strand	213	1	7
β-strand	214-216	3	4
β-strand	219-222	4	4
α-helix	227-229	3
β-strand	231-238	8	6
β-strand	244-251	8	6
β-strand	253	1	5

Chain C: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	29-30	2
β-strand	31-35	5	8
β-strand	40-42	3	9
β-strand	45	1	10
α-helix	53-56	4
β-strand	60-67	8	8
α-helix	89-93	5
β-strand	95-100	6	8
α-helix	109-111	3
β-strand	116-118	3	9
α-helix	123-125	3
β-strand	127	1	10
β-strand	130-132	3	9
α-helix	137-139	3
β-strand	141-148	8	8
β-strand	153-163	11	8
β-strand	165-170	6	11
β-strand	174-175	2	12
β-strand	181-187	7	11
α-helix	192-193	2
β-strand	195-200	6	13
β-strand	205-207	3	13
β-strand	210	1	14
β-strand	213	1	14
β-strand	214-216	3	11
β-strand	219-222	4	11
α-helix	227-229	3
β-strand	231-238	8	13
β-strand	244-251	8	13
β-strand	252-253	2	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lymphocyte activation gene 3 protein	A, C	protein	232	Mus musculus	Q61790 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7TZE_1 Lymphocyte activation gene 3 protein (chains A, C)
SGPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGGVIWQHQPDSGQPTPIPALDLHQ
GMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEERGLQRGDFSLWLRPALRTDAGE
YHATVRLPNRALSCSLRLRVGQASMIASPSGVLKLSDWVLLNCSFSRPDRPVSVHWFQGQ
NRVPVYNSPRHFLAETFLLLPQVSPLDSGTWGCVLTYRDGFNVSITYNLKVL

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Water and common crystallization additives (EDO) are not listed.

Primary citation

LAG3 ectodomain structure reveals functional interfaces for ligand and antibody recognition. Ming, Q., Celias, D.P., Wu, C. et al. Nat Immunol (2022) 23:1031-1041. DOI 10.1038/s41590-022-01238-7 · PubMed

Other PDB entries of the same protein (UniProt Q61790 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8DGG 3.78 Å, Structure of glycosylated LAG-3 homodimer
9CYM 3.84 Å, Structure of LAG3 bound to the MHC class II molecule I-A(b)
9CYL 4.66 Å, Structure of LAG3 loop1 deletion bound to the MHC class II molecule I-A(b)

Browse structure collections

About this viewer

MolViewer shows 7TZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.