Human DNA polymerase eta-DNA ternary mismatch complex:reaction with 0.5 mM Mn2+ for 1800s then with 10 mM Mn2+ for 30s. Determined by X-ray diffraction at 1.52 Å resolution. Released 4 May 2022.
Explore 7U74 in 3D Show helices and sheets RCSB PDB PDBe
7U74 contains 22 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-14 | 6 | 1 |
| α-helix | 17-25 | 9 | |
| α-helix | 27-29 | 3 | |
| β-strand | 34-38 | 5 | 2 |
| β-strand | 46-50 | 5 | 2 |
| α-helix | 52-55 | 4 | |
| β-strand | 64 | 1 | 2 |
| α-helix | 65-71 | 7 | |
| β-strand | 76-79 | 4 | 2 |
| α-helix | 80-81 | 2 | |
| β-strand | 82-83 | 2 | 3 |
| β-strand | 86-87 | 2 | 3 |
| α-helix | 90-103 | 14 | |
| β-strand | 109-113 | 5 | 1 |
| β-strand | 116-120 | 5 | 1 |
| α-helix | 122-132 | 11 | |
| α-helix | 135-138 | 4 | |
| α-helix | 139-141 | 3 | |
| β-strand | 145-147 | 3 | 1 |
| α-helix | 163-176 | 14 | |
| α-helix | 186-208 | 23 | |
| β-strand | 212-217 | 6 | 1 |
| α-helix | 220-227 | 8 | |
| β-strand | 235-237 | 3 | 1 |
| α-helix | 243-248 | 6 | |
| β-strand | 251 | 1 | 4 |
| α-helix | 252-254 | 3 | |
| α-helix | 261-270 | 10 | |
| β-strand | 274 | 1 | 4 |
| α-helix | 275-280 | 6 | |
| α-helix | 283-290 | 8 | |
| α-helix | 292-301 | 10 | |
| β-strand | 313 | 1 | 1 |
| β-strand | 319-324 | 6 | 5 |
| α-helix | 327-329 | 3 | |
| β-strand | 331-333 | 3 | 5 |
| α-helix | 334-359 | 26 | |
| β-strand | 361-372 | 12 | 5 |
| β-strand | 381-386 | 6 | 5 |
| α-helix | 392-403 | 12 | |
| α-helix | 404-406 | 3 | |
| β-strand | 414-431 | 18 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA polymerase eta | A | protein | 435 | Homo sapiens | Q9Y253 (AlphaFold model) |
| DNA (5'-d(*cp*ap*tp*tp*ap*tp*gp*ap*cp*gp*cp*t)-3') | T | DNA | 12 | synthetic construct | |
| DNA (5'-d(*ap*gp*cp*gp*tp*cp*ap*t)-3') | P | DNA | 8 | synthetic construct |
>7U74_1 DNA polymerase eta (chains A) GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAF GVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEA YVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDS LQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSW LYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRN DNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSGIQTEWSP PLTMLFLCATKFSAS
>7U74_2 DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3') (chains T) CATTATGACGCT
>7U74_3 DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3') (chains P) AGCGTCAT
Water and common crystallization additives (GOL) are not listed.
In crystallo observation of three metal ion promoted DNA polymerase misincorporation. Chang, C., Lee Luo, C., Gao, Y. Nat Commun (2022) 13:2346-2346. DOI 10.1038/s41467-022-30005-3 · PubMed
Other PDB entries of the same protein (UniProt Q9Y253 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7U74 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.