Asp-bound GltPh RSMR mutant in IFS-A2 state. Determined by electron microscopy at 2.94 Å resolution. Released 29 Mar 2023.
Explore 7UGV in 3D Show helices and sheets RCSB PDB PDBe
7UGV contains 26 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-9 | 7 | |
| α-helix | 12-31 | 20 | |
| α-helix | 36-38 | 3 | |
| α-helix | 39-43 | 5 | |
| α-helix | 44-56 | 13 | |
| α-helix | 58-70 | 13 | |
| α-helix | 75-77 | 3 | |
| α-helix | 80-107 | 28 | |
| α-helix | 124-129 | 6 | |
| α-helix | 130-135 | 6 | |
| α-helix | 142-148 | 7 | |
| α-helix | 151-168 | 18 | |
| α-helix | 174-219 | 46 | |
| α-helix | 223-241 | 19 | |
| α-helix | 242-248 | 7 | |
| α-helix | 249-254 | 6 | |
| α-helix | 258-264 | 7 | |
| α-helix | 266-275 | 10 | |
| α-helix | 278-291 | 14 | |
| α-helix | 296-299 | 4 | |
| α-helix | 302-309 | 8 | |
| α-helix | 312-329 | 18 | |
| α-helix | 335-351 | 17 | |
| α-helix | 358-369 | 12 | |
| α-helix | 377-388 | 12 | |
| α-helix | 390-416 | 27 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glutamate transporter homolog | A | protein | 418 | Pyrococcus horikoshii | O59010 (AlphaFold model) |
>7UGV_1 Glutamate transporter homolog (chains A) MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMP IVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQ QFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSA ETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAHVMAHQGVHVVGELAKVTAAVYVGLT LQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTSSSSGTLPVTMRVAKEMGISEGIYS FTLPLGATINMDGTALYQGVATFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGA IMLAMVLHSVGLPLTDPNVAAAYACILGIDAILDRGRTMVNVTGDLTGTAIVAKTEGT
| ID | Name | Formula | Copies |
|---|---|---|---|
| ASP | Aspartic acid | C4 H7 N O4 | 1 |
Water and common crystallization additives (NA) are not listed.
Environmentally Ultrasensitive Fluorine Probe to Resolve Protein Conformational Ensembles by 19 F NMR and Cryo-EM. Huang, Y., Reddy, K.D., Bracken, C. et al. J Am Chem Soc (2023) 145:8583-8592. DOI 10.1021/jacs.3c01003 · PubMed
Other PDB entries of the same protein (UniProt O59010 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7UGV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.