9BH2: Apo GltPh, outward-facing state

Apo GltPh, outward-facing state. Determined by electron microscopy at 2.7 Å resolution. Released 12 Mar 2025.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Pyrococcus horikoshii
Chains: 1
Atoms: 3,078
Mol. weight: 44.64 kDa
Released: 12 Mar 2025

Explore 9BH2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BH2 contains 24 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	4-9	6
α-helix	12-33	22
α-helix	36-38	3
α-helix	39-43	5
α-helix	44-72	29
α-helix	75-107	33
α-helix	127-129	3
α-helix	130-136	7
α-helix	142-147	6
α-helix	151-169	19
α-helix	174-220	47
α-helix	221-223	3
α-helix	227-241	15
α-helix	242-247	6
α-helix	248-253	6
α-helix	258-275	18
α-helix	282-291	10
α-helix	296-309	14
α-helix	312-329	18
α-helix	337-347	11
α-helix	348-352	5
α-helix	358-370	13
α-helix	377-387	11
α-helix	390-415	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate transporter homolog	A	protein	422	Pyrococcus horikoshii	O59010 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9BH2_1 Glutamate transporter homolog (chains A)
MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMP
IVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQ
QFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSA
ETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLT
LQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYS
FTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGA
IMLAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTEGTLV
PR

Primary citation

Evolutionary analysis reveals the origin of sodium coupling in glutamate transporters. Reddy, K.D., Rasool, B., Akher, F.B. et al. bioRxiv (2024). DOI 10.1101/2023.12.03.569786 · PubMed

Other PDB entries of the same protein (UniProt O59010 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RCP 2.2 Å, GltPh mutant (S279E/D405N) in complex with aspartate and sodium ions
7AHK 2.5 Å, Crystal structure of the outward-facing state of the substrate-free Na+-only bound…
7UG0 2.55 Å, TBOA-bound GltPh RSMR mutant in IFS state
7UGJ 2.81 Å, TBOA-bound GltPh RSMR mutant in OFS state
7UGV 2.94 Å, Asp-bound GltPh RSMR mutant in IFS-A2 state
7UGD 2.95 Å, Asp-bound GltPh RSMR mutant in IFS-A1 state
2NWL 2.96 Å, Crystal structure of GltPh in complex with L-Asp
7UGX 2.96 Å, Asp-bound GltPh RSMR mutant in IFS-B1 state
7UH3 2.99 Å, Asp-bound GltPh RSMR mutant in iOFS state
6X15 3.05 Å, Inward-facing state of the glutamate transporter homologue GltPh in complex with…
6UWF 3.08 Å, GltPh in complex with L-aspartate and sodium ions in outward-facing state
9BH1 3.1 Å, Apo GltPh, intermediate outward-facing state

Browse structure collections

About this viewer

MolViewer shows 9BH2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.