7UL4: Inactive MOR

CryoEM Structure of Inactive MOR Bound to Alvimopan and Mb6. Determined by electron microscopy at 2.8 Å resolution. Released 29 Jun 2022.

Method: Electron microscopy
Resolution: 2.8 Å
Organisms: Mus musculus, synthetic construct
Chains: 2
Atoms: 2,524
Mol. weight: 104.01 kDa
Ligands: NG0
Released: 29 Jun 2022

Explore 7UL4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UL4 contains 13 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	66-95	30
α-helix	102-119	18
α-helix	121-130	10
α-helix	137-170	34
α-helix	172-178	7
α-helix	181-205	25
β-strand	207-210	4	1
β-strand	215-218	4	1
α-helix	226-237	12
α-helix	238-242	5
α-helix	243-260	18
α-helix	269-304	36
α-helix	308-310	3
α-helix	312-339	28
α-helix	341-351	11

Chain D: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	406-408	3	2
β-strand	415-422	8	3
β-strand	434-437	4	3
β-strand	442	1	3
β-strand	455-457	3	2
β-strand	462-464	3	2
β-strand	479-485	7	3
β-strand	493-496	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mu-type opioid receptor	A	protein	426	Mus musculus	P42866 (AlphaFold model)
Megabody 6	D	protein	516	synthetic construct

Sequence of entity 1 (A), FASTA

>7UL4_1 Mu-type opioid receptor (chains A)
MKTIIALSYIFCLVFADYKDDDDAMGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQS
DPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMK
TATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCT
MSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLT
FSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRLLSGSREKDRNLRRITR
MVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLD
ENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQLENLEAETAPLPDI
HHHHHH

Sequence of entity 2 (D), FASTA

>7UL4_2 Megabody 6 (chains D)
QVQLQESGGGLVRKTTTSVIDTTNDAQNLLTQAQTIVNTLKDYCPILIAKSSSSNGGTNN
ANTPSWQTAGGGKNSCATFGAEFSAASDMINNAQKIVQETQQLSANQPKNITQPHNLNLN
SPSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGHLKDYIGKCDASAISSANMTM
QNQKNNWGNGCAGVEETQSLLKTSAADFNNQTPQINQAQNLANTLIQELGNNTYEQLSRL
LTNDNGTNSKTSAQAINQAVNNLNERAKTLAGGTTNSPAYQATLLALRSVLGLWNSMGYA
VICGGYTKSPGENNQKDFHYTDENGNGTTINCGGSTNSNGTHSYNGTNTLKADKNVSLSI
EQYEKIHEAYQILSKALKQAGLAPLNSKGEKLEAHVTTSKPSLRLSCAASGTIFRLYDMG
WYRRVSGNQRELVASITSGGSTKYGDSVKGRFTISRDNAKNTVYLQMSSLKPEDTAVYYC
NAEYRTGIWEELLDGWGQGTQVTVSSHHHHHHEPEA

Ligands and cofactors

ID	Name	Formula	Copies
NG0	N-[(2S)-2-{[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]methyl}-3-ph…	C25 H32 N2 O4	1

Primary citation

Structure determination of inactive-state GPCRs with a universal nanobody. Robertson, M.J., Papasergi-Scott, M.M., He, F. et al. Nat Struct Mol Biol (2022) 29:1188-1195. DOI 10.1038/s41594-022-00859-8 · PubMed

Other PDB entries of the same protein (UniProt P42866 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5C1M 2.07 Å, Crystal structure of active mu-opioid receptor bound to the agonist BU72
8E0G 2.1 Å, Re-refined model of active mu-opioid receptor (PDB 5c1m) as an adduct with BU72
9O36 2.3 Å, CryoEM structure of mu-opioid receptor - Gi protein complex bound to fluornitrazene (FNZ)
9ODF 2.4 Å, Structure of the MOR/Gi/Lofentanil Complex, GTP-bound G-Primed
9ODN 2.4 Å, Structure of the MOR/Gi/DAMGO Complex, GTP-Bound, G-Primed
7T2G 2.5 Å, CryoEM structure of mu-opioid receptor - Gi protein complex bound to mitragynine…
9ODE 2.5 Å, Structure of the MOR/Gi/Lofentanil Complex, Nucleotide Free
4DKL 2.8 Å, Crystal structure of the mu-opioid receptor bound to a morphinan antagonist
9ODM 2.8 Å, Structure of the MOR/Gi/DAMGO Complex, Nucleotide Free, Baseline
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSW 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-Gz-scFv16 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex

Browse structure collections

About this viewer

MolViewer shows 7UL4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.