7UMN: H1 Solomon Islands 2006 hemagglutinin

H1 Solomon Islands 2006 hemagglutinin in complex with Ab36. Determined by electron microscopy at 3.6 Å resolution. Released 19 Apr 2023.

Method: Electron microscopy
Resolution: 3.6 Å
Organisms: Influenza A virus (A/Solomon Islands/3/2006(H1N1)), Mus musculus
Chains: 9
Atoms: 12,375
Mol. weight: 321.8 kDa
Released: 19 Apr 2023

Explore 7UMN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UMN contains 36 α-helices and 168 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 8 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	47	1	1
β-strand	54-55	2	2
α-helix	61-66	6
α-helix	75-77	3
β-strand	79	1	3
β-strand	83-85	3	2
β-strand	99	1	4
α-helix	102-111	10
β-strand	114	1	3
β-strand	117-118	2	4
β-strand	130-131	2	5
β-strand	136	1	6
α-helix	137-139	3
β-strand	146	1	6
β-strand	151-153	3	4
β-strand	155-156	2	5
β-strand	157	1	7
β-strand	160	1	7
β-strand	164	1	8
β-strand	167-169	3	8
β-strand	176-184	9	4
α-helix	188-194	7
β-strand	202-206	5	8
β-strand	209-213	5	8
α-helix	220-222	3
β-strand	223	1	9
β-strand	226	1	9
β-strand	229-237	9	4
β-strand	242-247	6	8
β-strand	251-254	4	4
β-strand	257-259	3	4
β-strand	261	1	3
β-strand	268-270	3	2
β-strand	279	1	1
β-strand	282-284	3	10
β-strand	287-289	3	10
β-strand	295-296	2	11
β-strand	303-304	2	10
β-strand	308-309	2	11
α-helix	572-574	3
α-helix	575-591	17

Chains H and J: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	34
β-strand	10-12	3	35
β-strand	18-24	7	34
α-helix	29-31	3
β-strand	33-39	7	35
β-strand	45-51	7	35
β-strand	58-60	3	35
β-strand	65	1	34
β-strand	68-73	6	34
β-strand	78-83	6	34
α-helix	88-90	3
β-strand	92-99	8	35
β-strand	109-112	4	35
β-strand	116-120	5	35

Chain I: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	36
β-strand	10-12	3	37
β-strand	18-24	7	36
α-helix	29-31	3
β-strand	33-39	7	37
β-strand	45-52	8	37
β-strand	57-60	4	37
β-strand	65	1	36
β-strand	68-73	6	36
β-strand	78-83	6	36
α-helix	88-90	3
β-strand	92-99	8	37
β-strand	109-112	4	37
β-strand	116-120	5	37

Chains L, M and N: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	40
β-strand	10-11	2	41
β-strand	17-25	9	40
α-helix	30-32	3
β-strand	33-38	6	42
β-strand	45-48	4	42
β-strand	54	1	42
β-strand	63-67	5	40
β-strand	70-78	9	40
β-strand	85-90	6	42
α-helix	97-98	2
β-strand	99-102	4	42
β-strand	103-104	2	41

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hemagglutinin	A, B, C	protein	523	Influenza A virus (A/Solomon Islands/3/2006(H1N1))	A7Y8I1
Ab36 Fab heavy chain	H, I, J	protein	234	Mus musculus
Ab36 Fab light chain	L, M, N	protein	215	Mus musculus

Sequence of entity 1 (A, B, C), FASTA

>7UMN_1 Hemagglutinin (chains A, B, C)
ADPGYLLEDTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCLLKGIAPLQL
GNCSVAGWILGNPECELLISRESWSYIVEKPNPENGTCYPGHFADYEELREQLSSVSSFE
RFEIFPKESSWPNHTTTGVSASCSHNGESSFYKNLLWLTGKNGLYPNLSKSYANNKEKEV
LVLWGVHHPPNIGDQRALYHTENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTL
LEPGDTIIFEANGNLIAPRYAFALSRGFGSGIINSNAPMDECDAKCQTPQGAINSSLPFQ
NVHPVTIGECPKYVRSAKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHH
QNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLERRMENLNKKVDD
GFIDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCND
ECMESVKNGTYDYPKYSEESKLNREKIDGVRSGSGGALEVLFQ

Sequence of entity 2 (H, I, J), FASTA

>7UMN_2 Ab36 Fab heavy chain (chains H, I, J)
EFQLQQSGPELVKPGASVKISCKASGYSFTDYNMNWVKQSDGKSLEWIGIINPNYGIISY
NQKFKGKATLTVDQSSSTAYMQLNSLTSEDSAVYYCARWGNSPYYYYYMDVWGKGTTVTV
SGAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQ
SDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGGSGLEVLFQ

Sequence of entity 3 (L, M, N), FASTA

>7UMN_3 Ab36 Fab light chain (chains L, M, N)
ENVLTQSPAIMSASPGEKVTMTCRATSSVSSSYLHWYQQKSGASPKLWIYGTSNLASGVP
ARFSGSGSGTSYSLTISTVEAEDAATYYCQQYSGYPLTFGAGTKLELKRADGAPTVSIFP
PSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTL
TLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Primary citation

H1 Solomon Islands 2006 hemagglutinin in complex with Ab36. Carradona, T. To be published.

Other PDB entries of the same protein (UniProt A7Y8I1), best resolution first:

6CF7 2.72 Å, Crystal structure of the A/Solomon Islands/3/2006(H1N1) influenza virus hemagglutinin in…
6FYT 2.8 Å, Structure of H1 (A/solomon Islands/3/06) Influenza Hemagglutinin in complex with SD38
5UGY 2.8 Å, Influenza hemagglutinin in complex with a neutralizing antibody
9CU7 2.82 Å, Structure of 16.ND.92 Fab in complex with A/Solomon Islands/3/2006(H1N1) influenza virus…
6OC3 2.85 Å, Crystal structure of FluA-20 Fab in complex with the head domain of H1 (A/Solomon…
9DBX 2.9 Å, Structure of AG11-2F01 Fab in complex with A/Solomon Islands/3/2006 (H1N1) influenza…
7UMM 3.36 Å, H1 Solomon Islands 2006 hemagglutinin in complex with Ab109
8U44 3.41 Å, CryoEM structure of A/Solomon Islands/3/2006 H1 HA in complex with 05.GC.w2.3C10-H1_SI06
6XSK 3.85 Å, Cryo-EM Structure of Vaccine-Elicited Rhesus Antibody 789-203-3C12 in Complex with…
6WIZ 4.2 Å, Crystal structure of Fab 54-1G05 bound to H1 influenza hemagglutinin

Browse structure collections

About this viewer

MolViewer shows 7UMN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.