9CU7: 16.ND.92 Fab

Structure of 16.ND.92 Fab in complex with A/Solomon Islands/3/2006(H1N1) influenza virus Hemagglutinin. Determined by electron microscopy at 2.82 Å resolution. Released 30 Jul 2025.

Method: Electron microscopy
Resolution: 2.82 Å
Organisms: Homo sapiens, Influenza A virus (A/Solomon Islands/3/2006(H1N1))
Chains: 12
Atoms: 16,913
Mol. weight: 242.17 kDa
Released: 30 Jul 2025

Explore 9CU7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CU7 contains 49 α-helices and 218 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	12-17	6	19
β-strand	18	1	20
β-strand	25-26	2	21
β-strand	34-35	2	21
β-strand	36	1	22
β-strand	39-41	3	23
β-strand	43-44	2	24
β-strand	51-54	4	25
β-strand	56	1	25
β-strand	59-60	2	26
α-helix	66-71	6
β-strand	87-89	3	26
β-strand	102	1	27
α-helix	105-112	8
β-strand	115-122	8	27
α-helix	125A-125C	3
β-strand	131	1	28
β-strand	136-141	6	29
β-strand	144-146	3	29
β-strand	151-153	3	27
β-strand	155	1	28
β-strand	157	1	30
β-strand	160	1	30
β-strand	164-169	6	31
β-strand	176-184	9	27
α-helix	188-194	7
β-strand	202-205	4	31
β-strand	210-213	4	31
β-strand	229-237	9	27
α-helix	238	1
β-strand	242-247	6	31
β-strand	252-254	3	27
β-strand	256-262	7	27
β-strand	267-269	3	26
α-helix	272-273	2
β-strand	274-279	6	25
β-strand	281-283	3	32
β-strand	286-287	2	32
β-strand	294-295	2	24
β-strand	302-303	2	32
β-strand	305	1	33
α-helix	306	1
β-strand	307-308	2	24
β-strand	315-317	3	23
β-strand	321	1	22

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	65
β-strand	10	1	65
β-strand	14	1	20
β-strand	22-28	7	19
β-strand	31-36	6	19
α-helix	38-57	20
α-helix	60-61	2
β-strand	62	1	33
α-helix	72-74	3
α-helix	75-126	52
α-helix	127-129	3
β-strand	130-132	3	19
β-strand	137-140	4	19
α-helix	146-154	9
α-helix	159-169	11

Chain C: 7 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	12-17	6	34
β-strand	18	1	35
β-strand	25-26	2	36
β-strand	34-35	2	36
β-strand	36	1	37
β-strand	39-41	3	38
β-strand	43-44	2	39
β-strand	51-54	4	40
β-strand	56	1	40
α-helix	57-58	2
β-strand	59-62	4	41
α-helix	66-71	6
β-strand	83A	1	42
β-strand	87-89	3	41
β-strand	102	1	42
α-helix	105-112	8
β-strand	115-122	8	42
β-strand	130-131	2	43
β-strand	136-141	6	44
β-strand	144-146	3	44
β-strand	151-153	3	42
β-strand	155-156	2	43
β-strand	157	1	45
β-strand	160	1	45
β-strand	164-169	6	46
β-strand	176-184	9	42
α-helix	188-195	8
β-strand	202-205	4	46
β-strand	210-213	4	46
β-strand	223	1	47
β-strand	226	1	47
β-strand	229-237	9	42
α-helix	238	1
β-strand	242-247	6	46
β-strand	252-254	3	42
β-strand	256-262	7	42
β-strand	267-269	3	41
α-helix	272-273	2
β-strand	274-279	6	40
β-strand	281-283	3	48
β-strand	286-288	3	48
β-strand	294-295	2	39
β-strand	302-303	2	48
β-strand	305	1	49
α-helix	306	1
β-strand	307-308	2	39
β-strand	315-317	3	38
β-strand	321	1	37

Chain D: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	66
β-strand	10	1	66
β-strand	14	1	35
β-strand	22-28	7	34
β-strand	31-36	6	34
α-helix	38-57	20
α-helix	60-61	2
β-strand	62	1	49
β-strand	65	1	48
α-helix	72-74	3
α-helix	75-126	52
α-helix	127-129	3
β-strand	130-132	3	34
β-strand	137-140	4	34
α-helix	146-154	9
α-helix	159-169	11

Chain E: 5 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	12-17	6	50
β-strand	18	1	51
β-strand	25-26	2	52
β-strand	34-35	2	52
β-strand	36	1	53
β-strand	39-41	3	54
β-strand	43-44	2	55
β-strand	51-54	4	56
β-strand	56	1	56
β-strand	59-60	2	57
α-helix	66-71	6
β-strand	83A	1	58
β-strand	87-89	3	57
β-strand	102	1	58
α-helix	105-112	8
β-strand	115-122	8	58
α-helix	125A-125C	3
β-strand	130-131	2	59
β-strand	136-141	6	60
β-strand	144-146	3	60
β-strand	151-153	3	58
β-strand	155-156	2	59
β-strand	157	1	61
β-strand	160	1	61
β-strand	164-169	6	62
β-strand	176-184	9	58
α-helix	188-195	8
β-strand	202-205	4	62
β-strand	210-213	4	62
β-strand	229-237	9	58
β-strand	242-247	6	62
β-strand	252-254	3	58
β-strand	256-262	7	58
β-strand	267-269	3	57
β-strand	274-279	6	56
β-strand	281-283	3	63
β-strand	286-288	3	63
β-strand	294-295	2	55
β-strand	302-303	2	63
β-strand	305	1	64
α-helix	306	1
β-strand	307-308	2	55
β-strand	315-317	3	54
β-strand	321	1	53

Chain F: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	67
β-strand	10	1	67
β-strand	14	1	51
β-strand	22-28	7	50
β-strand	31-36	6	50
α-helix	38-57	20
α-helix	60-61	2
β-strand	62	1	64
α-helix	75-126	52
α-helix	127-129	3
β-strand	130-132	3	50
β-strand	137-140	4	50
α-helix	146-154	9
α-helix	159-169	11

Chain H: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	17-25	9	1
α-helix	29-31	3
β-strand	32-39	8	3
β-strand	45-51	7	3
β-strand	57-59	3	3
β-strand	67-72	6	1
β-strand	77-82A	7	1
β-strand	88-96	9	3
β-strand	100	1	4
β-strand	100C	1	4
β-strand	102-103	2	3
β-strand	107-109	3	3
β-strand	110-111	2	2

Chain I: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	5
β-strand	11-12	2	6
β-strand	17-25	9	5
α-helix	29-31	3
β-strand	32-39	8	7
β-strand	45-51	7	7
β-strand	57-59	3	7
β-strand	67-72	6	5
β-strand	77-82A	7	5
β-strand	88-96	9	7
α-helix	97-98	2
β-strand	100	1	8
β-strand	100C	1	8
β-strand	102-103	2	7
β-strand	107-109	3	7
β-strand	110-111	2	6

3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Variable Heavy Chain of 16.ND.92 Fab	H, I, J	protein	127	Homo sapiens
Variable Light Chain of 16.ND.92 Fab	L, M, N	protein	107	Homo sapiens
Hemagglutinin HA1	A, C, E	protein	321	Influenza A virus (A/Solomon Islands/3/2006(H1N1))	A7Y8I1
Hemagglutinin HA2	B, D, F	protein	169	Influenza A virus (A/Solomon Islands/3/2006(H1N1))	B9W1X0

Sequence of entity 1 (H, I, J), FASTA

>9CU7_1 Variable Heavy Chain of 16.ND.92 Fab (chains H, I, J)
VQLVESGGGLVQPGGSLRLSCEASGFTLSSYWMHWVRQDPGKGLVWVAVINSDGSSTDYA
DFVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCARAPQGTVFGVVIIGADGFDIWGQG
TMVTVSS

Sequence of entity 2 (L, M, N), FASTA

>9CU7_2 Variable Light Chain of 16.ND.92 Fab (chains L, M, N)
IQMTHIPVSLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASTLESGVPSR
FSGSGSGTDFTLTINSLQPDDFATYYCQHYNTYSRAWTFGQGTKVEV

Sequence of entity 3 (A, C, E), FASTA

>9CU7_3 Hemagglutinin HA1 (chains A, C, E)
DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRLKGIAPLQLGNCSVAGW
ILGNPECELLISRESWSYIVEKPNPENGTCYPGHFADYEELREQLSSVSSFERFEIFPKE
SSWPNHTTTGVSASCSHNGESSFYKNLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHH
PPNIGDQRALYHKENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTLLEPGDTII
FEANGNLIAPRYAFALSRGFGSGIINSNAPMDECDAKCQTPQGAINSSLPFQNVHPVTIG
ECPKYVRSAKLRMVTGLRNIP

Sequence of entity 4 (B, D, F), FASTA

>9CU7_4 Hemagglutinin HA2 (chains B, D, F)
LFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNT
QFTAVGKEFNKLERRMENLNKKVDDGFIDIWTYNAELLVLLENERTLDFHDSNVKNLYEK
VKSQLKNNAKEIGNGCFEFYHKCNDECMESVKNGTYDYPKYSEESKLNR

Primary citation

High-throughput synthesis and specificity characterization of natively paired influenza hemagglutinin antibodies with oPool + display. Ouyang, W.O., Lv, H., Liu, W. et al. Sci Transl Med (2025) 17:eadt4147-eadt4147. DOI 10.1126/scitranslmed.adt4147 · PubMed

Other PDB entries of the same protein (UniProt A7Y8I1), best resolution first:

6CF7 2.72 Å, Crystal structure of the A/Solomon Islands/3/2006(H1N1) influenza virus hemagglutinin in…
6FYT 2.8 Å, Structure of H1 (A/solomon Islands/3/06) Influenza Hemagglutinin in complex with SD38
5UGY 2.8 Å, Influenza hemagglutinin in complex with a neutralizing antibody
6OC3 2.85 Å, Crystal structure of FluA-20 Fab in complex with the head domain of H1 (A/Solomon…
9DBX 2.9 Å, Structure of AG11-2F01 Fab in complex with A/Solomon Islands/3/2006 (H1N1) influenza…
7UMM 3.36 Å, H1 Solomon Islands 2006 hemagglutinin in complex with Ab109
8U44 3.41 Å, CryoEM structure of A/Solomon Islands/3/2006 H1 HA in complex with 05.GC.w2.3C10-H1_SI06
7UMN 3.6 Å, H1 Solomon Islands 2006 hemagglutinin in complex with Ab36
6XSK 3.85 Å, Cryo-EM Structure of Vaccine-Elicited Rhesus Antibody 789-203-3C12 in Complex with…
6WIZ 4.2 Å, Crystal structure of Fab 54-1G05 bound to H1 influenza hemagglutinin

Browse structure collections

About this viewer

MolViewer shows 9CU7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.