7UOV: Native Lassa glycoprotein

Native Lassa glycoprotein in complex with neutralizing antibodies 12.1F and 37.2D. Determined by electron microscopy at 2.75 Å resolution. Released 2 Nov 2022.

Method: Electron microscopy
Resolution: 2.75 Å
Organisms: Homo sapiens, Lassa virus
Chains: 18
Atoms: 19,757
Mol. weight: 340.33 kDa
Ligands: NAG
Released: 2 Nov 2022

Explore 7UOV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UOV contains 84 α-helices and 196 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	278-280	3	10
β-strand	285	1	8
β-strand	291-293	3	10
α-helix	295-298	4
α-helix	299-302	4
α-helix	308-325	18
α-helix	334-340	7
α-helix	347-358	12
β-strand	363	1	11
β-strand	368-374	7	7
β-strand	380	1	7
α-helix	381-383	3
β-strand	384-385	2	7
α-helix	386-387	2
β-strand	388-389	2	11
β-strand	392-393	2	11
α-helix	394-395	2
α-helix	396-398	3
α-helix	400-415	16

Chain A: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	61-62	2	7
β-strand	66-72	7	7
β-strand	73	1	8
α-helix	75-78	4
β-strand	84-87	4	9
β-strand	92-97	6	9
β-strand	101-108	8	9
α-helix	121-125	5
α-helix	131-142	12
α-helix	150-152	3
β-strand	153-156	4	9
α-helix	158-160	3
β-strand	163-167	5	9
α-helix	183-194	12
α-helix	200-202	3
β-strand	219-226	8	9
β-strand	237	1	9
α-helix	239-244	6

Chain b: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	278-280	3	27
β-strand	285	1	25
β-strand	291-293	3	27
α-helix	295-299	5
α-helix	300-302	3
α-helix	308-325	18
α-helix	334-339	6
α-helix	347-358	12
β-strand	363	1	28
β-strand	368-374	7	24
β-strand	380	1	24
α-helix	381-383	3
β-strand	384-385	2	24
α-helix	386-387	2
β-strand	388-389	2	28
β-strand	392-393	2	28
α-helix	396-398	3
α-helix	400-415	16

Chain B: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	61-62	2	24
β-strand	66-72	7	24
β-strand	73	1	25
α-helix	75-78	4
β-strand	84-87	4	26
β-strand	92-97	6	26
β-strand	101-108	8	26
α-helix	120-125	6
α-helix	131-142	12
α-helix	150-152	3
β-strand	153-156	4	26
α-helix	158-160	3
β-strand	163-167	5	26
α-helix	183-194	12
α-helix	199-202	4
β-strand	219-226	8	26
β-strand	237	1	26
α-helix	239-246	8
α-helix	252-254	3

Chain c: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	278-280	3	43
β-strand	285	1	41
β-strand	291-293	3	43
α-helix	295-298	4
α-helix	299-302	4
α-helix	308-325	18
α-helix	334-339	6
α-helix	347-358	12
β-strand	363	1	44
β-strand	368-374	7	40
β-strand	380	1	40
α-helix	381-383	3
β-strand	384-385	2	40
α-helix	386-387	2
β-strand	388-389	2	44
β-strand	392-393	2	44
α-helix	394-395	2
α-helix	396-399	4
α-helix	400-415	16

Chain C: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	61-62	2	40
β-strand	66-72	7	40
β-strand	73	1	41
α-helix	75-77	3
β-strand	84-87	4	42
β-strand	92-97	6	42
β-strand	101-108	8	42
α-helix	120-125	6
α-helix	131-142	12
α-helix	150-152	3
β-strand	153-156	4	42
α-helix	158-160	3
β-strand	163-166	4	42
α-helix	183-194	12
α-helix	199-201	3
β-strand	219-225	7	42
β-strand	237	1	42
α-helix	239-244	6

Chain D: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	19-23	5	18
β-strand	33-39	7	19
β-strand	46-51	6	19
β-strand	57-59	3	19
α-helix	64-66	3
β-strand	67-72	6	18
β-strand	77-82	6	18
α-helix	87-89	3
β-strand	92-100	9	19
β-strand	108	1	20
β-strand	109-113	5	19

Chain E: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	21
β-strand	10-12	3	22
β-strand	19-25	7	21
β-strand	32	1	20
β-strand	34-38	5	22
β-strand	45-49	5	22
β-strand	53-54	2	22
β-strand	62-67	6	21
β-strand	70-75	6	21
α-helix	80-82	3
β-strand	85-89	5	22
β-strand	90	1	23
β-strand	97	1	23
β-strand	102-105	4	22

10 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
12.1F heavy chain (variable domain)	D, F, H	protein	114	Homo sapiens
12.1F light chain (variable domain)	E, G, L	protein	106	Homo sapiens
Glycoprotein G1	A, B, C	protein	259	Lassa virus	P08669 (AlphaFold model)
Glycoprotein G2	a, b, c	protein	232	Lassa virus	P08669 (AlphaFold model)
37.2D light chain (variable domain)	P, R, T	protein	105	Homo sapiens
37.2D heavy chain (variable domain)	O, Q, S	protein	126	Homo sapiens

Sequence of entity 1 (D, F, H), FASTA

>7UOV_1 12.1F heavy chain (variable domain) (chains D, F, H)
QVQLQESGAGLLKPSETLSLSCTVDGESFNGFFWTWIRQPPGKGLEWIGEINHLASTGYN
PSLKSRVTISVDTSKNQFSLKLTSVTAADTAVYYCARGYSYGFAWPNYHYLDVW

Sequence of entity 2 (E, G, L), FASTA

>7UOV_2 12.1F light chain (variable domain) (chains E, G, L)
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQHKPGQAPRLLIYGASKRATGIPS
RFSGSGSGTDFSLTISSLEPEDFAVYYCQHRSDWRTTFGQGTRLEI

Sequence of entity 3 (A, B, C), FASTA

>7UOV_3 Glycoprotein G1 (chains A, B, C)
MGQIVTFFQEVPHVIEEVMNIVLIALSVLAVLKGLYNFATCGLVGLVTFLLLCGRSCTTS
LYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNL
SDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHC
GTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIG
YLGLLSQRTRDIYISRRLL

Sequence of entity 4 (a, b, c), FASTA

>7UOV_4 Glycoprotein G2 (chains a, b, c)
GTFTWTLSDSEGKDTPGGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFN
KQAIQRLKAEAQTSIQLINKAVNALINDQLIMKNHLRDIMGIPYCNYSKYWYLNHTTTGR
TSLPKCWLVSNGSYLNETHFSDDIEQQADNMITEMLQKEYMERQGKTPLGLVDLFVFSTS
FYLISIFLHLVKIPTHRHIVGKSCPKPHRLNHMGICSCGLYKQPGVPVKWKR

Sequence of entity 5 (P, R, T), FASTA

>7UOV_5 37.2D light chain (variable domain) (chains P, R, T)
ETTLTQSPATLSVSPGETATLSCRASQNVINNLAWYQQKPGQAPRLLIYGASTRATGIPA
RFSGSGSGTEFTLTISSMQSEDFAVYYCQQYNDWPRSFGQGTRLD

Sequence of entity 6 (O, Q, S), FASTA

>7UOV_6 37.2D heavy chain (variable domain) (chains O, Q, S)
EVQLVQSGAEVKKPGASVKVSCKASGYTFTKYGISWVRQAPGQGLEWMGWISAFNGYTRY
GQRFQGKVTMTTDTSTNTASLEVRTLTSNDTAVYYCARQYPDQYSSSGWPRLFAMDVWGQ
GTTVTV

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

A cocktail of protective antibodies subverts the dense glycan shield of Lassa virus. Li, H., Buck, T., Zandonatti, M. et al. Sci Transl Med (2022) 14:eabq0991-eabq0991. DOI 10.1126/scitranslmed.abq0991 · PubMed

Other PDB entries of the same protein (UniProt P08669 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9MJ1 1.9 Å, Native tagless Lassa virus spike complex bound at pH 8.0
9MHE 2.01 Å, Native tagless Lassa virus spike complex bound to ARN-75039 at pH 8.0
9MIV 2.02 Å, Native tagless Lassa virus spike complex pH 6.0
5OMI 2.56 Å, Crystal structure of GP2 from Lassa virus in a post fusion conformation
9MJ2 2.58 Å, Flag-tag Lassa virus spike complex at pH 6.0
4ZJF 2.6 Å, Crystal structure of GP1 - the receptor binding domain of Lassa virus
7S8H 2.7 Å, Structure of Lassa virus glycoprotein bound to Fab 18.5C and Fab 36.1F
9MIY 2.72 Å, Focused reconstruction of the transmembrane region of the Lassa virus spike complex
7UOT 2.77 Å, Native Lassa glycoprotein in complex with neutralizing antibodies 8.9F and 37.2D
7TYV 2.8 Å, Structure of Lassa Virus glycoprotein (Josiah) bound to Fab 25.10C
8VCV 2.8 Å, Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody…
8VE8 2.8 Å, Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody…

Browse structure collections

About this viewer

MolViewer shows 7UOV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.