9MIY: Pre-glycoprotein polyprotein GP complex

Focused reconstruction of the transmembrane region of the Lassa virus spike complex. Determined by electron microscopy at 2.72 Å resolution. Released 27 Aug 2025.

Method: Electron microscopy
Resolution: 2.72 Å
Organism: Lassa virus Josiah
Chains: 6
Atoms: 2,388
Mol. weight: 99.35 kDa
Released: 27 Aug 2025

Explore 9MIY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MIY contains 16 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	409-425	17
α-helix	428-450	23

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	4-9	6
α-helix	11-14	4
α-helix	18-39	22
α-helix	43-53	11

Chain b: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	409-423	15
α-helix	428-450	23

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	4-9	6
α-helix	18-41	24
α-helix	43-53	11

Chain c: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	409-425	17
α-helix	428-449	22

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	4-9	6
α-helix	18-40	23
α-helix	43-53	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-glycoprotein polyprotein GP complex	A, B, C	protein	58	Lassa virus Josiah	P08669 (AlphaFold model)
Glycoprotein G2	a, b, c	protein	232	Lassa virus Josiah	P08669 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>9MIY_1 Pre-glycoprotein polyprotein GP complex (chains A, B, C)
MGQIVTFFQEVPHVIEEVMNIVLIALSVLAVLKGLYNFATCGLVGLVTFLLLCGRSCT

Sequence of entity 2 (a, b, c), FASTA

>9MIY_2 Glycoprotein G2 (chains a, b, c)
GTFTWTLSDSEGKDTPGGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFN
KQAIQRLKAEAQMSIQLINKAVNALINDQLIMKNHLRDIMGIPYCNYSKYWYLNHTTTGR
TSLPKCWLVSNGSYLNETHFSDDIEQQADNMITEMLQKEYMERQGKTPLGLVDLFVFSTS
FYLISIFLHLVKIPTHRHIVGKSCPKPHRLNHMGICSCGLYKQPGVPVKWKR

Primary citation

pH-induced conformational changes and inhibition of the Lassa virus spike complex. Katz, M., Cohen-Dvashi, H., Borni, S. et al. Cell Host Microbe (2025) 33:1577-1588.e7. DOI 10.1016/j.chom.2025.07.020 · PubMed

Other PDB entries of the same protein (UniProt P08669 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9MJ1 1.9 Å, Native tagless Lassa virus spike complex bound at pH 8.0
9MHE 2.01 Å, Native tagless Lassa virus spike complex bound to ARN-75039 at pH 8.0
9MIV 2.02 Å, Native tagless Lassa virus spike complex pH 6.0
5OMI 2.56 Å, Crystal structure of GP2 from Lassa virus in a post fusion conformation
9MJ2 2.58 Å, Flag-tag Lassa virus spike complex at pH 6.0
4ZJF 2.6 Å, Crystal structure of GP1 - the receptor binding domain of Lassa virus
7S8H 2.7 Å, Structure of Lassa virus glycoprotein bound to Fab 18.5C and Fab 36.1F
7UOV 2.75 Å, Native Lassa glycoprotein in complex with neutralizing antibodies 12.1F and 37.2D
7UOT 2.77 Å, Native Lassa glycoprotein in complex with neutralizing antibodies 8.9F and 37.2D
7TYV 2.8 Å, Structure of Lassa Virus glycoprotein (Josiah) bound to Fab 25.10C
8VCV 2.8 Å, Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody…
8VE8 2.8 Å, Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody…

Browse structure collections

About this viewer

MolViewer shows 9MIY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.