7URV: FMC63 scFv

FMC63 scFv in complex with soluble CD19. Determined by electron microscopy at 3.05 Å resolution. Released 15 Feb 2023.

Method: Electron microscopy
Resolution: 3.05 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 3,460
Mol. weight: 54.1 kDa
Released: 15 Feb 2023

Explore 7URV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7URV contains 6 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 3 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	24-29	6	1
β-strand	34	1	2
β-strand	50-56	7	1
β-strand	59-66	8	1
β-strand	71-75	5	3
β-strand	80-85	6	3
α-helix	89-91	3
β-strand	93-97	5	1
β-strand	108-115	8	1
β-strand	120-123	4	4
β-strand	130	1	5
α-helix	154	1
β-strand	155-159	5	4
β-strand	164-166	3	4
β-strand	173	1	5
β-strand	187-190	4	1
β-strand	195-198	4	3
α-helix	203-205	3
β-strand	212-218	7	1
β-strand	221-230	10	1
β-strand	239-241	3	3
β-strand	246-247	2	3
β-strand	248	1	2
β-strand	257-262	6	1
β-strand	267-275	9	1

Chain D: 3 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	42-43	2	6
β-strand	48-51	4	7
β-strand	57-63	7	6
β-strand	71-76	6	7
β-strand	82-84	3	7
β-strand	86-87	2	8
β-strand	91-92	2	8
α-helix	93	1
β-strand	100-105	6	6
β-strand	108-113	6	6
α-helix	118-120	3
β-strand	122-128	7	7
β-strand	135-136	2	7
β-strand	140-144	5	7
β-strand	163-167	5	9
β-strand	178	1	9
β-strand	181-185	5	9
β-strand	194-198	5	7
β-strand	206-211	6	7
β-strand	217-219	3	7
β-strand	227-232	6	9
β-strand	237-242	6	9
α-helix	247-249	3
β-strand	251-253	3	10
β-strand	254-258	5	7
β-strand	267-270	4	7
β-strand	274-276	3	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-lymphocyte antigen CD19	C	protein	257	Homo sapiens	P15391 (AlphaFold model)
FMC63 single-chain variable fragment	D	protein	242	Mus musculus

Sequence of entity 1 (C), FASTA

>7URV_1 B-lymphocyte antigen CD19 (chains C)
EEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHVSPLAI
WLFISNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRS
SEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSC
GVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGKYY
CHRGNLTMSFHLEITAR

Sequence of entity 2 (D), FASTA

>7URV_2 FMC63 single-chain variable fragment (chains D)
DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPS
RFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEITGGGGSGGGGSGGG
GSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTY
YNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTV
SS

Primary citation

CD19 CAR antigen engagement mechanisms and affinity tuning. He, C., Mansilla-Soto, J., Khanra, N. et al. Sci Immunol (2023) 8:eadf1426-eadf1426. DOI 10.1126/sciimmunol.adf1426 · PubMed

Other PDB entries of the same protein (UniProt P15391 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AL5 3.0 Å, Complex between CD19 (N138Q mutant) and B43 FAB
7URX 3.4 Å, SJ25C1 Fab in complex with soluble CD19
7JIC 3.8 Å, Structure of human CD19-CD81 co-receptor complex bound to coltuximab Fab fragment

Browse structure collections

About this viewer

MolViewer shows 7URV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.