7V1K: Apo structure of sNASP core

Apo structure of sNASP core. Determined by X-ray diffraction at 3.29 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 3.29 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,740
Mol. weight: 28.26 kDa
Released: 20 Apr 2022

Explore 7V1K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7V1K contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	39-54	16
α-helix	59-77	19
α-helix	82-84	3
α-helix	85-98	14
α-helix	171-191	21
α-helix	196-215	20
α-helix	219-236	18
α-helix	242-257	16
α-helix	261-303	43
α-helix	304-306	3
α-helix	307-324	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Nuclear autoantigenic sperm protein	A	protein	252	Homo sapiens	P49321 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7V1K_1 Isoform 2 of Nuclear autoantigenic sperm protein (chains A)
SADKVESLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLLGKKYGETANECGEAFF
FYGKSLLELARLENKSLQENEEEEIGNLELAWDMLDLAKIIFKRQETKEAQLYAAQAHLK
LGEVSVESENYVQAVEEFQSCLNLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQF
SKSIEVIENRMAVLNEQVKEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAE
LALKATLVESST

Primary citation

NASP maintains histone H3-H4 homeostasis through two distinct H3 binding modes. Bao, H., Carraro, M., Flury, V. et al. Nucleic Acids Res (2022) 50:5349-5368. DOI 10.1093/nar/gkac303 · PubMed

Other PDB entries of the same protein (UniProt P49321 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7V1M 2.83 Å, Structural basis for the co-chaperone relationship of sNASP and ASF1b
7V1L 2.85 Å, Structure of sNASP core in complex with H3 alpha3 helix peptide
7V6P 2.9 Å, Crystal structure of human sNASP TPR domain
7V6Q 3.0 Å, Crystal structure of sNASP-ASF1A-H3.1-H4 complex

Browse structure collections

About this viewer

MolViewer shows 7V1K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.