7V6P: Human sNASP TPR domain

Name: PDB 7V6P: Crystal structure of human sNASP TPR domain
Published: 2021-12-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of human sNASP TPR domain. Determined by X-ray diffraction at 2.9 Å resolution. Released 29 Dec 2021.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,848
Mol. weight: 32.68 kDa
Ligands: CA
Released: 29 Dec 2021

Explore 7V6P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7V6P contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	41-56	16
α-helix	59-77	19
α-helix	82-84	3
α-helix	85-101	17
α-helix	169-192	24
α-helix	196-215	20
α-helix	219-236	18
α-helix	242-257	16
α-helix	261-319	59

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Nuclear autoantigenic sperm protein	A	protein	283	Homo sapiens	P49321 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7V6P_1 Isoform 2 of Nuclear autoantigenic sperm protein (chains A)
DPDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLE
LARMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNIDETEGSEEDDKENDKTEEMPND
SVLENKSLQENEEEEIGNLELAWDMLDLAKIIFKRQETKEAQLYAAQAHLKLGEVSVESE
NYVQAVEEFQSCLNLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFSKSIEVIEN
RMAVLNEQVKEAEGSSAEYKKEIEELKELLPEIREKIEDAKES

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Water and common crystallization additives (GOL, PEG) are not listed.

Primary citation

Distinct histone H3-H4 binding modes of sNASP reveal the basis for cooperation and competition of histone chaperones. Liu, C.P., Jin, W., Hu, J. et al. Genes Dev (2021) 35:1610-1624. DOI 10.1101/gad.349100.121 · PubMed

Other PDB entries of the same protein (UniProt P49321 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7V1M 2.83 Å, Structural basis for the co-chaperone relationship of sNASP and ASF1b
7V1L 2.85 Å, Structure of sNASP core in complex with H3 alpha3 helix peptide
7V6Q 3.0 Å, Crystal structure of sNASP-ASF1A-H3.1-H4 complex
7V1K 3.29 Å, Apo structure of sNASP core

Browse structure collections

About this viewer

MolViewer shows 7V6P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.