7V3Z: Cannabinoid receptor type 1(CB1)

Structure of cannabinoid receptor type 1(CB1). Determined by X-ray diffraction at 3.29 Å resolution. Released 24 Nov 2021.

Method: X-ray diffraction
Resolution: 3.29 Å
Organisms: Homo sapiens, Desulfovibrio vulgaris str. Hildenborough
Chains: 1
Atoms: 3,398
Mol. weight: 49.82 kDa
Ligands: 9GF, CLR, FMN
Released: 24 Nov 2021

Explore 7V3Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7V3Z contains 17 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	105-108	4
α-helix	113-144	32
α-helix	154-178	25
α-helix	186-219	34
α-helix	224-227	4
α-helix	230-249	20
α-helix	251-253	3
α-helix	263	1
β-strand	264	1	1
α-helix	265	1
β-strand	272	1	1
α-helix	273-305	33
β-strand	307-314	8	2
α-helix	319-333	15
β-strand	336-342	7	2
β-strand	357-362	6	2
β-strand	365	1	3
β-strand	371	1	3
α-helix	376-381	6
β-strand	392-396	5	2
β-strand	398	1	4
α-helix	408-419	12
β-strand	431	1	4
α-helix	439-451	13
α-helix	461-489	29
α-helix	495-518	24
α-helix	524-531	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
fusion protein of Cannabinoid receptor 1 and Flavodoxin	A	protein	438	Homo sapiens, Desulfovibrio vulgaris str. Hildenborough	P00323 (AlphaFold model), P21554 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7V3Z_1 fusion protein of Cannabinoid receptor 1 and Flavodoxin (chains A)
GENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYLFIGS
LAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLAAIDRYISI
HRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDKTYLMF
WIGVVSVLLLFIVYAYMYILWKAHSHAVAKALIVYGSTTGNTEYTAETIARELADAGYEV
DSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGC
GDSSWEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAIPDQAR
MDIELAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPII
YALRSKDLRHAFRSMFPS

Ligands and cofactors

ID	Name	Formula	Copies
9GF	2-[(1R,2R,5R)-5-hydroxy-2-(3-hydroxypropyl)cyclohexyl]-5-(2-methyloctan-2-yl)ph…	C24 H40 O3	1
CLR	Cholesterol	C27 H46 O	1
FMN	Flavin mononucleotide	C17 H21 N4 O9 P	1

Primary citation

A Genetically Encoded F-19 NMR Probe Reveals the Allosteric Modulation Mechanism of Cannabinoid Receptor 1. Wang, X., Liu, D., Shen, L. et al. J Am Chem Soc (2021) 143:16320-16325. DOI 10.1021/jacs.1c06847 · PubMed

Other PDB entries of the same protein (UniProt P00323 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YOB 1.14 Å, Crystal Structure of flavodoxin without engineered disulfide bond
1F4P 1.3 Å, Y98W flavodoxin mutant 1.5A (D. Vulgaris)
1J8Q 1.35 Å, Low Temperature (100K) Crystal Structure of Flavodoxin D. vulgaris Wild-type at 1.35…
5YOE 1.35 Å, Crystal Structure of flavodoxin with engineered disulfide bond A43C-L74C
5YOG 1.42 Å, Crystal Structure of flavodoxin with engineered disulfide bond N14C-C93
1J9E 1.44 Å, Low Temperature (100K) Crystal Structure of Flavodoxin D. vulgaris S35C Mutant at 1.44…
5YOC 1.5 Å, Crystal Structure of flavodoxin with engineered disulfide bond C102-R125C
1AKR 1.58 Å, G61A oxidized flavodoxin mutant
1WSW 1.69 Å, Low Temperature (100K) Crystal Structure Of Flavodoxin Mutant S64C, dimer, semiquinone…
1XYY 1.7 Å, Low Temperature (100K) Crystal Structure Of Flavodoxin Mutant S64C, homodimer, oxidised…
1AKW 1.75 Å, G61L oxidized flavodoxin mutant
1XYV 1.79 Å, Low Temperature (100K) Crystal Structure Of Flavodoxin Mutant S64C, monomer, semiquinone…

Browse structure collections

About this viewer

MolViewer shows 7V3Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.