7VBF: Nucleoprotein

1.3 Angstrom Resolution Crystal Structure of SARS-CoV-2 Nucleocapsid dimerization domain, pH 8.5. Determined by X-ray diffraction at 1.3 Å resolution. Released 6 Jul 2022.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Severe acute respiratory syndrome coronavirus 2
Chains: 2
Atoms: 2,011
Mol. weight: 26.6 kDa
Released: 6 Jul 2022

Explore 7VBF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VBF contains 17 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	259-261	3
β-strand	265	1	1
β-strand	268	1	1
α-helix	270-274	5
β-strand	286	1	2
α-helix	289-294	6
α-helix	295-297	3
α-helix	301-305	5
α-helix	309-310	2
α-helix	311-317	7
β-strand	319-325	7	3
β-strand	328-338	11	3
α-helix	346-356	11
β-strand	357	1	2
α-helix	359-362	4

Chain B: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	259-261	3
β-strand	265	1	4
β-strand	268	1	4
α-helix	270-274	5
β-strand	286	1	5
α-helix	289-294	6
β-strand	295	1	4
α-helix	301-305	5
α-helix	309-310	2
α-helix	311-317	7
β-strand	319-325	7	3
β-strand	328-338	11	3
α-helix	346-356	11
β-strand	357	1	5
α-helix	359-362	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoprotein	A, B	protein	116	Severe acute respiratory syndrome coronavirus 2	P0DTC9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7VBF_1 Nucleoprotein (chains A, B)
HHHHHHSKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFA
PSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP

Primary citation

1.3 Angstrom Resolution Crystal Structure of SARS-CoV-2 Nucleocapsid dimerization domain, pH 8.5. Zhou, X.L., Zhong, F.L., Li, J. et al. To be published.

Other PDB entries of the same protein (UniProt P0DTC9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LUZ 1.1 Å, GQTVTK segment from the Nucleoprotein of SARS-CoV-2, residues 243-248
7LTU 1.12 Å, Aalall segment from the nucleoprotein of SARS-CoV-2, residues 217-222, crystal form 1
9F2H 1.3 Å, Crystal structure of SARS-CoV-2 N-protein C-terminal domain in complex with riluzole
7LV2 1.3 Å, GSQASS segment from the Nucleoprotein of SARS-CoV-2, residues 179-184
7LUX 1.3 Å, AALALL segment from the Nucleoprotein of SARS-CoV-2, residues 217-222, crystal form 2
7KGQ 1.34 Å, Crystal Structure of HLA-A*0201in complex with SARS-CoV-2 N222-230
6ZCO 1.36 Å, Crystal Structure of C-terminal Dimerization Domain of Nucleocapsid Phosphoprotein from…
7KGP 1.4 Å, Crystal Structure of HLA-A*0201 in complex with SARS-CoV-2 N316-324
9IN1 1.4 Å, Crystal Structure of C-terminal domain of nucleocapsid protein from SARS-CoV-2
6WZO 1.42 Å, Structure of SARS-CoV-2 Nucleocapsid dimerization domain, P1 form
7N0R 1.42 Å, Structure of the SARS-CoV-2 N protein RNA-binding domain bound to single-domain antibody…
6YUN 1.44 Å, 1.45 Angstrom Resolution Crystal Structure of C-terminal Dimerization Domain of…

Browse structure collections

About this viewer

MolViewer shows 7VBF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.