7VC9: Tom20 subunits

Tom20 subunits. Determined by electron microscopy at 13.0 Å resolution. Released 7 Sept 2022.

Method: Electron microscopy
Resolution: 13.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,416
Mol. weight: 32.64 kDa
Released: 7 Sept 2022

Explore 7VC9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VC9 contains 8 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain M: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	64-81	18
α-helix	84-95	12
β-strand	101	1	1
β-strand	104	1	1
α-helix	107-113	7
α-helix	125-144	20

Chain N: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	64-81	18
α-helix	85-98	14
α-helix	102-113	12
α-helix	122-144	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial import receptor subunit TOM20 homolog	M, N	protein	145	Homo sapiens	Q15388 (AlphaFold model)

Sequence of entity 1 (M, N), FASTA

>7VC9_1 Mitochondrial import receptor subunit TOM20 homolog (chains M, N)
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDL
KDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQ
MLLTKLPTISQRIVSAQSLAEDDVE

Primary citation

Structural basis of Tom20 and Tom22 cytosolic domains as the human TOM complex receptors. Su, J., Liu, D., Yang, F. et al. Proc Natl Acad Sci U S A (2022) 119:e2200158119-e2200158119. DOI 10.1073/pnas.2200158119 · PubMed

Other PDB entries of the same protein (UniProt Q15388 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4APO 1.9 Å, AIP TPR domain in complex with human Tomm20 peptide
7VBY 2.54 Å, Tom core complex with Tom20 and Tom22 subunits.
9EII 2.75 Å, Import stalled PINK1 TOM complex, symmetry expanded
9EIH 3.1 Å, Import stalled PINK1 TOM complex
8UY3 3.2 Å, Fem1B with FNIP1 and Tom20 fragment
9EIJ 3.3 Å, Import stalled PINK1 TOM complex, extended TOM20 helix class
9JCE 3.59 Å, local refinement of FEM1B bound with TOM20
9J79 4.08 Å, Cryo-EM structure of CRL2-FEM1B bound with TOM20(tetramer)
9J7B 4.12 Å, local refinement of FEM1B bound with TOM20(tetramer)
9J7A 4.13 Å, local refinement of FEM1B bound with TOM20 (dimer)
8XVA 5.92 Å, Human TOM complex with whole Tom20

Browse structure collections

About this viewer

MolViewer shows 7VC9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.