7VCL: Viral protein BKRF4

structure of viral protein BKRF4 in complex with H2A-H2B. Determined by X-ray diffraction at 3.2 Å resolution. Released 3 Aug 2022.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Homo sapiens, Epstein-Barr virus (strain GD1)
Chains: 2
Atoms: 1,452
Mol. weight: 29.82 kDa
Released: 3 Aug 2022

Explore 7VCL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VCL contains 11 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	12-22	11
β-strand	27-28	2	1
β-strand	29	1	2
α-helix	30-57	28
α-helix	65-75	11
α-helix	78-97	20
α-helix	104-108	5
α-helix	114-123	10
α-helix	134-159	26
β-strand	164-165	2	1
α-helix	167-175	9
α-helix	178-185	8

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	82	1
β-strand	83	1	2
α-helix	84	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
histone H2A-H2B	A	protein	199	Homo sapiens	P04908 (AlphaFold model), P06899 (AlphaFold model)
Tegument protein BKRF4	B	protein	70	Epstein-Barr virus (strain GD1)	P30117 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7VCL_1 histone H2A-H2B (chains A)
KKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKR
STITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAKKAKTRSSRAGLQFPVGRVHRL
LRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEEL
NKLLGRVTIAQGGVLPNIQ

Sequence of entity 2 (B), FASTA

>7VCL_2 Tegument protein BKRF4 (chains B)
GLPGSDTDESDYSDEDEEIDLEEEYPSDEDPSEGSDSDPSWHPSDSDESDYSESDEDEAT
PGSQASRSSR

Primary citation

Epstein-Barr Virus Tegument Protein BKRF4 is a Histone Chaperone. Liu, Y., Li, Y., Bao, H. et al. J Mol Biol (2022) 434:167756-167756. DOI 10.1016/j.jmb.2022.167756 · PubMed

Other PDB entries of the same protein (UniProt P04908 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7VZ4 1.89 Å, Cryo-EM structure of human nucleosome core particle composed of the Widom 601L DNA…
6ACL 1.92 Å, histone lysine desuccinylase Sirt5 in complex with succinyl peptide H2AK95
8I17 1.98 Å, Structural basis for H2A-H2B recognitions by human Spt16
5B0Z 1.99 Å, The crystal structure of the nucleosome containing H3.2, at 1.98 A resolution
5Y0D 1.99 Å, Crystal Structure of the human nucleosome containing the H2B E76K mutant
6IPU 1.99 Å, Human nucleosome core particle containing 145 bp of DNA
8UQA 2.05 Å, Crystal structure of RNF168 (RING)-UbcH5c fused to H2A-H2B via a 12-residue linker
5Y0C 2.09 Å, Crystal Structure of the human nucleosome at 2.09 angstrom resolution
8Q3E 2.17 Å, High Resolution Structure of Nucleosome Core with Bound Foamy Virus GAG Peptide
5X7X 2.18 Å, The crystal structure of the nucleosome containing H3.3 at 2.18 angstrom resolution
5AV6 2.2 Å, human nucleosome core particle
5AV8 2.2 Å, human nucleosome core particle

Browse structure collections

About this viewer

MolViewer shows 7VCL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.