7VR6: MlaC from Escherichia coli in quasi-open state

Crystal structure of MlaC from Escherichia coli in quasi-open state. Determined by X-ray diffraction at 2.5 Å resolution. Released 21 Sept 2022.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Escherichia coli K-12
Chains: 1
Atoms: 1,616
Mol. weight: 23.47 kDa
Ligands: PEF
Released: 21 Sept 2022

Explore 7VR6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VR6 contains 11 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	27-44	18
α-helix	46-51	6
α-helix	53-55	3
α-helix	56-63	8
α-helix	65-67	3
β-strand	68	1	1
α-helix	70-78	9
α-helix	79-82	4
α-helix	87-109	23
β-strand	116-119	4	1
β-strand	130-138	9	1
α-helix	143-145	3
β-strand	146-154	9	1
β-strand	161-168	8	1
β-strand	171-172	2	1
α-helix	173-201	29
α-helix	204-205	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Intermembrane phospholipid transport system binding protein MlaC	A	protein	197	Escherichia coli K-12	P0ADV7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7VR6_1 Intermembrane phospholipid transport system binding protein MlaC (chains A)
MHHHHHHADQTNPYKLMDEAAQKTFDRLKNEQPQIRANPDYLRTIVDQELLPYVQVKYAG
ALVLGQYYKSATPAQREAYFAAFREYLKQAYGQALAMYHGQTYQIAPEQPLGDKTIVPIR
VTIIDPNGRPPVRLDFQWRKNSQTGNWQAYDMIAEGVSMITTKQNEWGTLLRTKGIDGLT
AQLKSISQQKITLEEKK

Ligands and cofactors

ID	Name	Formula	Copies
PEF	Di-palmitoyl-3-sn-phosphatidylethanolamine	C37 H74 N O8 P	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

MlaC belongs to a unique class of non-canonical substrate-binding proteins and follows a novel phospholipid-binding mechanism. Dutta, A., Prasad Kanaujia, S. J Struct Biol (2022) 214:107896-107896. DOI 10.1016/j.jsb.2022.107896 · PubMed

Other PDB entries of the same protein (UniProt P0ADV7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UWA 1.5 Å, Structure of E. coli phospholipid binding protein MlaC
6GKI 2.23 Å, Structure of E coli MlaC in Variously Loaded States
8I8X 3.25 Å, Cryo-EM Structure of OmpC3-MlaA-MlaC Complex in MSP2N2 Nanodiscs
8OJ4 4.35 Å, Structure of the MlaCD complex (1:6 stoichiometry)
8OJG 4.38 Å, Structure of the MlaCD complex (2:6 stoichiometry)

Browse structure collections

About this viewer

MolViewer shows 7VR6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.