7VRM: BRD2-BD2

crystal structure of BRD2-BD2 in complex with purine derivative. Determined by X-ray diffraction at 1.1 Å resolution. Released 1 Feb 2023.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,234
Mol. weight: 13.88 kDa
Ligands: TEP
Released: 1 Feb 2023

Explore 7VRM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VRM contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	346-360	15
α-helix	363-365	3
α-helix	366-369	4
α-helix	370-372	3
α-helix	378-381	4
α-helix	386-389	4
α-helix	396-404	9
α-helix	411-428	18
α-helix	434-451	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 2	A	protein	115	Homo sapiens	P25440 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7VRM_1 Bromodomain-containing protein 2 (chains A)
GSHMQDPEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVK
RKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD

Ligands and cofactors

ID	Name	Formula	Copies
TEP	Theophylline	C7 H8 N4 O2	2

Primary citation

Structural and biochemical insights into purine-based drug molecules in hBRD2 delineate a unique binding mode opening new vistas in the design of inhibitors of the BET family. Arole, A.H., Deshmukh, P., Sridhar, A. et al. Acta Crystallogr D Struct Biol (2023) 79:758-774. DOI 10.1107/S2059798323005211 · PubMed

Other PDB entries of the same protein (UniProt P25440 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IG6 0.91 Å, Ultra-high resolution crystal structure of second bromodomain of BRD2 in complex with…
5IBN 0.94 Å, Ultra high resolution crystal structure of the apo- form of second bromodomain of BRD2.
6DBC 1.05 Å, Second bromodomain of Human BRD2 with a Tetrahydroquinoline analogue
6DDJ 1.05 Å, Crystal Structure of the human BRD2 BD2 bromodimain in complex with a…
4J1P 1.08 Å, X-ray crystal structure of bromodomain 2 of human brd2 in complex with rvx208 to 1.08 A…
6I80 1.14 Å, Crystal Structure of the second bromodomain of BRD2 in complex with RT53
7VRQ 1.15 Å, crystal structure of BRD2-BD2 in complex with purine derivative
24KK 1.2 Å, Crystal structure of the second bromodomain (BD2) of human BRD2 in complex with…
5O38 1.2 Å, Human Brd2(BD2) mutant in free form
5O3I 1.2 Å, Human Brd2(BD2) mutant in complex with AL-tBu
7USG 1.2 Å, BRD2-BD2 in complex with MDP5
7VS0 1.25 Å, crystal structure of BRD2-BD2 in complex with purine derivative

Browse structure collections

About this viewer

MolViewer shows 7VRM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.