7VUO: Kv7.1 C-terminal Domain

Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation F141L. Determined by X-ray diffraction at 2.68 Å resolution. Released 9 Nov 2022.

Method: X-ray diffraction
Resolution: 2.68 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,527
Mol. weight: 24.89 kDa
Ligands: CA
Released: 9 Nov 2022

Explore 7VUO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VUO contains 11 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	367-383	17
α-helix	390-394	5
α-helix	508-532	25

Chain C: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-19	13
β-strand	27	1	1
α-helix	29-38	10
α-helix	45-53	9
β-strand	63	1	1
α-helix	65-72	8
α-helix	82-90	9
β-strand	99-101	3	2
α-helix	102-111	10
α-helix	118-125	8
β-strand	135-137	3	2
α-helix	138-144	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kv7.1	A	protein	69	Homo sapiens	P51787 (AlphaFold model)
Calmodulin-1	C	protein	148	Homo sapiens	P0DP23 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7VUO_1 Kv7.1 (chains A)
FNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIRISQLREHHRATIKVIRRMQYFVAKKK
FQQARIGSG

Sequence of entity 2 (C), FASTA

>7VUO_2 Calmodulin-1 (chains C)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE
VDEMIREADIDGDGQVNYEELVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation F141L. Chen, L. To be published.

Other PDB entries of the same protein (UniProt P51787 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HFE 1.7 Å, A trimeric form of the Kv7.1 A domain Tail
3BJ4 2.0 Å, The KCNQ1 (Kv7.1) C-terminus, a multi-tiered scaffold for subunit assembly and protein…
7VVH 2.3 Å, Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease…
3HFC 2.45 Å, A trimeric form of the Kv7.1 A domain Tail, L602M/L606M mutant Semet
7XNN 2.5 Å, human KCNQ1-CaM-ML277-PIP2 complex in state B
9UJ4 2.59 Å, Structure of human KCNQ1-CaM complex
7XNK 2.6 Å, human KCNQ1-CaM in complex with ML277
9VEC 2.7 Å, structure of human KCNQ1-KCNE1-CaM complex
4V0C 2.86 Å, Crystal Structure of the Kv7.1 proximal C-terminal Domain in Complex with Calmodulin
8SIK 2.9 Å, KCNQ1 with voltage sensor in the up conformation
9U7F 2.9 Å, structure of human KCNQ1-KCNE1-CaM complex
4UMO 3.0 Å, Crystal Structure of the Kv7.1 proximal C-terminal Domain in Complex with Calmodulin

Browse structure collections

About this viewer

MolViewer shows 7VUO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.