7W29: SETD3-SAH

Crystal Structure of SETD3-SAH in complex with betaA-Orn73 peptide. Determined by X-ray diffraction at 2.9 Å resolution. Released 5 Oct 2022.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,057
Mol. weight: 59.49 kDa
Ligands: SAH
Released: 5 Oct 2022

Explore 7W29 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7W29 contains 26 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	21-35	15
α-helix	38-41	4
α-helix	45-61	17
α-helix	74-77	4
α-helix	78-86	9
β-strand	95-100	6	2
β-strand	104-109	6	2
β-strand	113	1	3
β-strand	118-123	6	1
α-helix	124-126	3
β-strand	128-129	2	4
α-helix	130-134	5
α-helix	139-144	6
α-helix	146-150	5
α-helix	152-164	13
α-helix	172-175	4
α-helix	185-187	3
α-helix	190-194	5
α-helix	201-225	25
α-helix	227-229	3
α-helix	240-253	14
β-strand	254-258	5	4
β-strand	265-269	5	4
α-helix	273-275	3
β-strand	277-278	2	5
β-strand	285-288	4	1
β-strand	293-297	5	1
β-strand	302	1	3
β-strand	307	1	2
α-helix	308	1
β-strand	309-310	2	5
α-helix	317-323	7
β-strand	335-341	7	6
α-helix	349-358	10
β-strand	364-370	7	6
α-helix	378-387	10
α-helix	391-398	8
α-helix	403-408	6
α-helix	419-438	20
α-helix	444-453	10
α-helix	458-493	36

Chain P: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	70	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin, cytoplasmic 1, N-terminally processed	P	protein	16	Homo sapiens	P60709 (AlphaFold model)
Histone-lysine N-methyltransferase setd3	A	protein	499	Homo sapiens	Q86TU7 (AlphaFold model)

Sequence of entity 1 (P), FASTA

>7W29_1 Actin, cytoplasmic 1, N-terminally processed (chains P)
TLKYPIEAGIVTNWDD

Sequence of entity 2 (A), FASTA

>7W29_2 Histone-lysine N-methyltransferase setd3 (chains A)
SMGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEK
IRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEEL
FLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTL
PSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSF
TYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVA
LQDFRAGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAEVLAR
AGIPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPVS
WDNEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAV
KSAAVNREYYRQQMEEKAP

Ligands and cofactors

ID	Name	Formula	Copies
SAH	S-adenosyl-L-homocysteine	C14 H20 N6 O5 S	1

Primary citation

Histidine methyltransferase SETD3 methylates structurally diverse histidine mimics in actin. Hintzen, J.C.J., Ma, H., Deng, H. et al. Protein Sci (2022) 31:e4305-e4305. DOI 10.1002/pro.4305 · PubMed

Other PDB entries of the same protein (UniProt P60709 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MBK 1.69 Å, SETD3, a Histidine Methyltransferase, in Complex with an Actin Peptide and SAH, First…
6OX0 1.75 Å, SETD3 in Complex with an Actin Peptide with Sinefungin Replacing SAH as Cofactor
6MBJ 1.78 Å, SETD3, a Histidine Methyltransferase, in Complex with an Actin Peptide and SAH, P21…
6OX3 1.78 Å, SETD3 in Complex with an Actin Peptide with His73 Replaced with Lysine
7W28 1.79 Å, Crystal Structure of SETD3-SAH in complex with betaA-4PyrAla73 peptide
6OX1 1.95 Å, SETD3 in Complex with an Actin Peptide with Target Histidine Partially Methylated
6ICT 1.95 Å, Structure of SETD3 bound to SAH and methylated actin
6OX2 2.09 Å, SETD3in Complex with an Actin Peptide with the Target Histidine Fully Methylated
6OX5 2.1 Å, A SETD3 Mutant (N255A) in Complex with an Actin Peptide with His73 Replaced with Lysine
6ICV 2.15 Å, Structure of SETD3 bound to SAH and unmodified actin
9QEW 2.18 Å, Cryo-EM structure of the undecorated actin filament in the ADP-Pi state.
6MBL 2.2 Å, SETD3, a Histidine Methyltransferase, in Complex with an Actin Peptide and SAH, Second…

Browse structure collections

About this viewer

MolViewer shows 7W29 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.