Crystal Structure of Human Gastrin Releasing Peptide Receptor in complex with the antagonist PD176252. Determined by X-ray diffraction at 2.95 Å resolution. Released 22 Feb 2023.
Explore 7W41 in 3D Show helices and sheets RCSB PDB PDBe
7W41 contains 22 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 39-42 | 4 | |
| α-helix | 43-67 | 25 | |
| α-helix | 74-102 | 29 | |
| α-helix | 109-142 | 34 | |
| α-helix | 150-152 | 3 | |
| α-helix | 153-178 | 26 | |
| β-strand | 180-186 | 7 | 1 |
| β-strand | 190-197 | 8 | 1 |
| α-helix | 205-215 | 11 | |
| α-helix | 216-220 | 5 | |
| α-helix | 221-239 | 19 | |
| α-helix | 250-252 | 3 | |
| α-helix | 257-267 | 11 | |
| β-strand | 274-279 | 6 | 2 |
| β-strand | 282 | 1 | 3 |
| α-helix | 289-300 | 12 | |
| α-helix | 305-307 | 3 | |
| β-strand | 308-313 | 6 | 2 |
| β-strand | 316 | 1 | 3 |
| α-helix | 318-330 | 13 | |
| β-strand | 334-337 | 4 | 2 |
| α-helix | 343-352 | 10 | |
| β-strand | 355-358 | 4 | 2 |
| α-helix | 367-373 | 7 | |
| α-helix | 377 | 1 | |
| β-strand | 378-382 | 5 | 2 |
| α-helix | 386-390 | 5 | |
| β-strand | 397-399 | 3 | 2 |
| α-helix | 404-419 | 16 | |
| α-helix | 423-474 | 52 | |
| α-helix | 482-509 | 28 | |
| α-helix | 511-520 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Gastrin-releasing peptide receptor,GlgA glycogen synthase | A | protein | 484 | Homo sapiens, Pyrococcus abyssi GE5 | P30550 (AlphaFold model), Q9V2J8 (AlphaFold model) |
>7W41_1 Gastrin-releasing peptide receptor,GlgA glycogen synthase (chains A) GILYVIPAVYGVIILIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVD ASRYLADRWLFGRIGCKLIPFIQLTSVGVKVFTLTALSADRYKAIVRPMDIQASHALMKA CLKAAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLV FYVIPLSIISVYYYFIAKNLIQSAGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFM FIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVI TEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGI LVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSKQIESEKRLAKTVLVFVGLF AFCWLPNHVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPFALYLLSKSFRKQF NTQL
| ID | Name | Formula | Copies |
|---|---|---|---|
| 8B8 | (2S)-3-(1H-indol-3-yl)-N-[[1-(5-methoxypyridin-2-yl)cyclohexyl]methyl]-2-methyl… | C32 H36 N6 O5 | 1 |
Structures of human gastrin-releasing peptide receptors bound to antagonist and agonist for cancer and itch therapy. Peng, S., Zhan, Y., Zhang, D. et al. Proc Natl Acad Sci U S A (2023) 120:e2216230120-e2216230120. DOI 10.1073/pnas.2216230120 · PubMed
Other PDB entries of the same protein (UniProt P30550 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7W41 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.