7WI6: LY341495/NAM-bound mGlu3

Cryo-EM structure of LY341495/NAM-bound mGlu3. Determined by electron microscopy at 3.71 Å resolution. Released 16 Mar 2022.

Method: Electron microscopy
Resolution: 3.71 Å
Organism: Homo sapiens
Chains: 2
Atoms: 9,696
Mol. weight: 201.19 kDa
Ligands: NAG, Z99
Released: 16 Mar 2022

Explore 7WI6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7WI6 contains 70 α-helices and 50 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 35 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	33-35	3	1
β-strand	39-45	7	1
α-helix	66-79	14
β-strand	91-97	7	1
α-helix	102-113	12
β-strand	145-146	2	1
β-strand	168-169	2	1
α-helix	177-179	3
β-strand	187	1	1
β-strand	189	1	2
β-strand	212-218	7	3
α-helix	227-229	3
α-helix	231-233	3
α-helix	235-237	3
β-strand	240-247	8	3
β-strand	271-274	4	3
β-strand	296-299	4	3
β-strand	321-325	5	3
α-helix	328-330	3
α-helix	331-337	7
α-helix	351-354	4
α-helix	400-408	9
α-helix	420-422	3
α-helix	427-434	8
β-strand	441	1	4
α-helix	442	1
β-strand	453	1	4
β-strand	461	1	2
α-helix	462-464	3
β-strand	466-470	5	3
β-strand	481-482	2	3
β-strand	484-485	2	5
β-strand	491-492	2	5
α-helix	515-517	3
β-strand	521	1	6
β-strand	530	1	6
β-strand	538-542	5	7
β-strand	545-548	4	7
α-helix	578-587	10
α-helix	591-597	7
α-helix	605-607	3
α-helix	616-624	9
α-helix	625-627	3
α-helix	629-631	3
α-helix	640-645	6
α-helix	650-653	4
α-helix	658-660	3
α-helix	662-664	3
α-helix	692-698	7
α-helix	704-708	5
β-strand	718-720	3	8
β-strand	726-728	3	8
α-helix	734-741	8
α-helix	744-750	7
α-helix	773-775	3
α-helix	780-783	4
α-helix	787-791	5
α-helix	798-801	4
α-helix	804-810	7
α-helix	817-819	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 3	A, B	protein	887	Homo sapiens	Q14832 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7WI6_1 Metabotropic glutamate receptor 3 (chains A, B)
MKTIIALSYIFCLVFADYKDDDDENLYFQGLGDHNFLRREIKIEGDLVLGGLFPINEKGT
GTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEF
VRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYA
STSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQ
EARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRAN
ASFTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFR
DFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLC
PNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQ
NVGGKYSYLKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICI
PCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTC
MVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSF
AICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAP
GTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIG
FTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQK
NVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
Z99	2-[(1S,2S)-2-carboxycyclopropyl]-3-(9H-xanthen-9-yl)-D-alanine	C20 H19 N O5	2

Primary citation

Structural basis of the activation of metabotropic glutamate receptor 3. Fang, W., Yang, F., Xu, C. et al. Cell Res (2022) 32:695-698. DOI 10.1038/s41422-022-00623-z · PubMed

Other PDB entries of the same protein (UniProt Q14832 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SM9 2.26 Å, Crystal Structure of Metabotropic glutamate receptor 3 precursor in presence of LY341495…
4XAR 2.26 Å, mGluR2 ECD and mGluR3 ECD complex with ligands
8JCU 2.8 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495 (dimerization mode I)
8JD2 2.8 Å, Cryo-EM structure of G protein-free mGlu2-mGlu3 heterodimer in Acc state
6B7H 2.82 Å, Structure of mGluR3 with an agonist
5CNM 2.84 Å, mGluR3 complexed with glutamate analog
8JCY 2.9 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495, NAM563, and…
8JCW 3.0 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495 and NAM563…
8JCX 3.0 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495 and NAM563…
8JCZ 3.0 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495, NAM563, and…
5CNK 3.15 Å, mglur3 with glutamate
8JD0 3.3 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of NAM563

Browse structure collections

About this viewer

MolViewer shows 7WI6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.