7WI8: Inactive mGlu3

Cryo-EM structure of inactive mGlu3 bound to LY341495. Determined by electron microscopy at 4.17 Å resolution. Released 16 Mar 2022.

Method: Electron microscopy
Resolution: 4.17 Å
Organism: Homo sapiens
Chains: 2
Atoms: 9,268
Mol. weight: 201.19 kDa
Ligands: Z99, NAG
Released: 16 Mar 2022

Explore 7WI8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7WI8 contains 76 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 38 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	33-35	3	1
β-strand	39-43	5	1
α-helix	66-79	14
β-strand	91-95	5	1
α-helix	102-113	12
β-strand	142-146	5	1
α-helix	151-154	4
β-strand	168-169	2	1
β-strand	187	1	1
β-strand	189	1	2
α-helix	192-193	2
α-helix	201-203	3
α-helix	205-208	4
β-strand	212-217	6	3
α-helix	223-231	9
β-strand	240-246	7	3
β-strand	272-274	3	3
α-helix	279-281	3
α-helix	282-285	4
α-helix	288-291	4
β-strand	297-299	3	3
β-strand	320-325	6	3
α-helix	331-337	7
α-helix	351-359	9
α-helix	390-396	7
α-helix	398-405	8
α-helix	407-411	5
α-helix	428-434	7
β-strand	441	1	4
β-strand	453	1	4
β-strand	461	1	2
α-helix	462-464	3
β-strand	466-470	5	3
β-strand	481-486	6	3
β-strand	490-492	3	3
α-helix	515-517	3
β-strand	521	1	5
β-strand	530	1	5
β-strand	538-539	2	6
β-strand	547-548	2	6
α-helix	553-555	3
α-helix	579-588	10
α-helix	590-594	5
α-helix	615-618	4
α-helix	621-632	12
α-helix	638-645	8
α-helix	648-650	3
α-helix	652-655	4
α-helix	657-666	10
α-helix	689-694	6
α-helix	696-698	3
α-helix	699-707	9
α-helix	734-740	7
α-helix	742-747	6
α-helix	750-752	3
α-helix	753-757	5
α-helix	772-788	17
α-helix	796-810	15
α-helix	811-815	5
α-helix	816-819	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 3	A, B	protein	887	Homo sapiens	Q14832 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7WI8_1 Metabotropic glutamate receptor 3 (chains A, B)
MKTIIALSYIFCLVFADYKDDDDENLYFQGLGDHNFLRREIKIEGDLVLGGLFPINEKGT
GTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEF
VRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYA
STSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQ
EARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRAN
ASFTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFR
DFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLC
PNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQ
NVGGKYSYLKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICI
PCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTC
MVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSF
AICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAP
GTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIG
FTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQK
NVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL

Ligands and cofactors

ID	Name	Formula	Copies
Z99	2-[(1S,2S)-2-carboxycyclopropyl]-3-(9H-xanthen-9-yl)-D-alanine	C20 H19 N O5	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Structural basis of the activation of metabotropic glutamate receptor 3. Fang, W., Yang, F., Xu, C. et al. Cell Res (2022) 32:695-698. DOI 10.1038/s41422-022-00623-z · PubMed

Other PDB entries of the same protein (UniProt Q14832 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SM9 2.26 Å, Crystal Structure of Metabotropic glutamate receptor 3 precursor in presence of LY341495…
4XAR 2.26 Å, mGluR2 ECD and mGluR3 ECD complex with ligands
8JCU 2.8 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495 (dimerization mode I)
8JD2 2.8 Å, Cryo-EM structure of G protein-free mGlu2-mGlu3 heterodimer in Acc state
6B7H 2.82 Å, Structure of mGluR3 with an agonist
5CNM 2.84 Å, mGluR3 complexed with glutamate analog
8JCY 2.9 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495, NAM563, and…
8JCW 3.0 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495 and NAM563…
8JCX 3.0 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495 and NAM563…
8JCZ 3.0 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495, NAM563, and…
5CNK 3.15 Å, mglur3 with glutamate
8JD0 3.3 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of NAM563

Browse structure collections

About this viewer

MolViewer shows 7WI8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.