7WIH: LY2794193-bound mGlu3

Cryo-EM structure of LY2794193-bound mGlu3. Determined by electron microscopy at 3.68 Å resolution. Released 16 Mar 2022.

Method: Electron microscopy
Resolution: 3.68 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,002
Mol. weight: 201.15 kDa
Ligands: NAG, CWY
Released: 16 Mar 2022

Explore 7WIH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7WIH contains 70 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 35 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	33-34	2	1
β-strand	39-41	3	2
β-strand	44-45	2	3
α-helix	66-77	12
β-strand	91-93	3	2
β-strand	94-95	2	1
β-strand	96-97	2	3
α-helix	102-113	12
β-strand	145	1	4
α-helix	152-155	4
β-strand	168	1	4
α-helix	177-179	3
β-strand	187	1	4
α-helix	195-202	8
β-strand	212-213	2	5
β-strand	214-217	4	6
α-helix	231-234	4
β-strand	240-241	2	5
β-strand	245-246	2	6
α-helix	257-260	4
α-helix	262-265	4
β-strand	271-274	4	6
β-strand	296-299	4	6
β-strand	321-322	2	6
α-helix	337-339	3
α-helix	354-358	5
α-helix	371-374	4
α-helix	388-390	3
α-helix	391-406	16
α-helix	408-411	4
α-helix	427-430	4
β-strand	469-470	2	7
β-strand	481-482	2	7
α-helix	500-502	3
β-strand	538-539	2	8
β-strand	547-548	2	8
β-strand	553-555	3	9
β-strand	562-564	3	9
α-helix	579-585	7
α-helix	588-593	6
α-helix	595	1
α-helix	596-600	5
α-helix	605-608	4
α-helix	615-618	4
α-helix	620-625	6
α-helix	641-651	11
α-helix	661-665	5
α-helix	691-695	5
α-helix	702-708	7
α-helix	734-749	16
α-helix	751-754	4
α-helix	767-771	5
α-helix	772-773	2
α-helix	774-778	5
α-helix	779-782	4
α-helix	786-788	3
α-helix	800-812	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 3	A, B	protein	887	Homo sapiens	Q14832 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7WIH_1 Metabotropic glutamate receptor 3 (chains A, B)
MKTIIALSYIFCLVFADYKDDDDENLYFQGLGDHNFLRREIKIEGDLVLGGLFPINEKGT
GTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEF
VRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYA
STSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQ
EARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRAN
ASFTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFR
DFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLC
PNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQ
NVGGKYSYLKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICI
PCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTC
MVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSF
AICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAP
GTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIG
FTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQK
NVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
CWY	(1S,2S,4S,5R,6S)-2-amino-4-[(3-methoxybenzene-1-carbonyl)amino]bicyclo[3.1.0]he…	C16 H18 N2 O6	2

Primary citation

Structural basis of the activation of metabotropic glutamate receptor 3. Fang, W., Yang, F., Xu, C. et al. Cell Res (2022) 32:695-698. DOI 10.1038/s41422-022-00623-z · PubMed

Other PDB entries of the same protein (UniProt Q14832 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SM9 2.26 Å, Crystal Structure of Metabotropic glutamate receptor 3 precursor in presence of LY341495…
4XAR 2.26 Å, mGluR2 ECD and mGluR3 ECD complex with ligands
8JCU 2.8 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495 (dimerization mode I)
8JD2 2.8 Å, Cryo-EM structure of G protein-free mGlu2-mGlu3 heterodimer in Acc state
6B7H 2.82 Å, Structure of mGluR3 with an agonist
5CNM 2.84 Å, mGluR3 complexed with glutamate analog
8JCY 2.9 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495, NAM563, and…
8JCW 3.0 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495 and NAM563…
8JCX 3.0 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495 and NAM563…
8JCZ 3.0 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495, NAM563, and…
5CNK 3.15 Å, mglur3 with glutamate
8JD0 3.3 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of NAM563

Browse structure collections

About this viewer

MolViewer shows 7WIH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.