7WQQ: Retinoic acid receptor alpha mutant - N299H

Retinoic acid receptor alpha mutant - N299H. Determined by X-ray diffraction at 1.9 Å resolution. Released 25 Jan 2023.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,060
Mol. weight: 32.11 kDa
Ligands: 5Z6
Released: 25 Jan 2023

Explore 7WQQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7WQQ contains 15 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	182-198	17
α-helix	202-204	3
β-strand	208	1	1
α-helix	222-245	24
α-helix	249-251	3
α-helix	254-274	21
β-strand	277-278	2	2
β-strand	283-285	3	2
β-strand	290	1	1
β-strand	291-293	3	2
α-helix	294-297	4
α-helix	298-302	5
α-helix	303-305	3
α-helix	306-316	11
α-helix	317-319	3
α-helix	323-334	12
α-helix	345-366	22
α-helix	373-401	29
α-helix	408-413	6

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	633-639	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoic acid receptor alpha	A	protein	265	Homo sapiens	P10276 (AlphaFold model)
Peptide from Nuclear receptor coactivator 1	C	protein	13	Homo sapiens	Q15788 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7WQQ_1 Retinoic acid receptor alpha (chains A)
MKSSHHHHHHENLYFQSNAESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQ
RVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTR
YTPEQDTMTFSDGLTLNRTQMHHAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLIC
GDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVI
TLKMEIPGSMPPLIQEMLENSEGLD

Sequence of entity 2 (C), FASTA

>7WQQ_2 Peptide from Nuclear receptor coactivator 1 (chains C)
RHKILHRLLQEGS

Ligands and cofactors

ID	Name	Formula	Copies
5Z6	4-[(E)-3-(3,5-ditert-butylphenyl)-3-oxidanylidene-prop-1-enyl]benzoic acid	C24 H28 O3	1

Primary citation

Effects of breast fibroepithelial tumor associated retinoic acid receptor alpha ligand binding domain mutations on receptor function and retinoid signaling. Huang, X.X., Ng, L.M., Teh, B.T. To be published.

Other PDB entries of the same protein (UniProt P10276 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GFE 1.58 Å, hRAR LBD protein in complex with AM580 agonist ligand and a stapled peptide
1DSZ 1.7 Å, Structure of the rxr/rar DNA-binding domain heterodimer in complex with the retinoic…
3KMR 1.8 Å, Crystal structure of RARalpha ligand binding domain in complex with an agonist ligand…
5K13 1.85 Å, Crystal structure of the RAR alpha ligand-binding domain in complex with an antagonist
3KMZ 2.1 Å, Crystal structure of RARalpha ligand binding domain in complex with the inverse agonist…
9GFI 2.1 Å, hRAR alpha LBD-AM580 complex with staple peptide
6XWG 2.4 Å, Crystal Structure of the Human RXR/RAR DNA-Binding Domain Heterodimer Bound to the Human…
7APO 2.4 Å, Crystal structure of RARalpha ligand binding domain in complex with a fragment of the…
1DKF 2.5 Å, Crystal structure of a heterodimeric complex of rar and rxr ligand-binding domains
7AOS 2.55 Å, crystal structure of the RARalpha/RXRalpha ligand binding domain heterodimer in complex…
3A9E 2.75 Å, Crystal structure of a mixed agonist-bound RAR-alpha and antagonist-bound RXR-alpha…
4DQM 2.75 Å, Revealing a marine natural product as a novel agonist for retinoic acid receptors with a…

Browse structure collections

About this viewer

MolViewer shows 7WQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.