7WR0: P32 of caspase-4 C258A mutant

P32 of caspase-4 C258A mutant. Determined by X-ray diffraction at 2.8 Å resolution. Released 25 Jan 2023.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,921
Mol. weight: 32.1 kDa
Released: 25 Jan 2023

Explore 7WR0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7WR0 contains 11 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	107-110	4
α-helix	111-120	10
α-helix	122-124	3
β-strand	125	1	1
β-strand	137-142	6	2
α-helix	156-168	13
α-helix	171	1
β-strand	172-177	6	2
α-helix	181-192	12
α-helix	195-197	3
β-strand	203-208	6	2
β-strand	211	1	3
β-strand	215-217	3	3
β-strand	228-230	3	3
α-helix	231-238	8
β-strand	251-256	6	2
β-strand	300-305	6	2
α-helix	309-311	3
β-strand	313	1	4
β-strand	320	1	4
α-helix	321-333	13
α-helix	339-349	11
β-strand	361-363	3	2
β-strand	370	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caspase-4	A	protein	280	Homo sapiens	P49662 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7WR0_1 Caspase-4 (chains A)
SGRPSTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADF
DITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGIC
GTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQAARGANRGELWVRDSPASLEV
ASSQSSENLEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCC
HLEEVFRKVQQSFETPRAKAQMPTIERLSMTRYFYLFPGN

Primary citation

Structural mechanisms of calmodulin activation of Shigella effector OspC3 to ADP-riboxanate caspase-4/11 and block pyroptosis. Hou, Y., Zeng, H., Li, Z. et al. Nat Struct Mol Biol (2023) 30:261-272. DOI 10.1038/s41594-022-00888-3 · PubMed

Other PDB entries of the same protein (UniProt P49662 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WR6 1.96 Å, Crystal structure of ADP-riboxanated caspase-4 in complex with Af1521
7WR1 2.13 Å, P32 of caspase-4 C258A mutant in complex with OspC3 C-terminal ankyrin-repeat domain
6NRY 2.18 Å, Crystal structure of human caspase-4
7WR4 2.75 Å, Crystal structure of OspC3-calmodulin-caspase-4 complex
7WR5 3.1 Å, Crystal structure of OspC3-calmodulin-caspase-4 complex binding with 2'-aF-NAD+
8J6K 3.12 Å, Crystal structure of pro-interleukin-18 and caspase-4 complex
8SPB 3.2 Å, Caspase-4/Pro-IL-18 complex
23BD 3.4 Å, Caspase-4 p22/p10 and human GSDMD complex
23BB 3.6 Å, Caspase-4 p20/p10 and human GSDMD
6KMZ 3.61 Å, caspase-4 P22/P10 C258A in complex with human GSDMD-C domain

Browse structure collections

About this viewer

MolViewer shows 7WR0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.