23BD: Caspase-4 p22/p10 and human GSDMD complex

Caspase-4 p22/p10 and human GSDMD complex. Determined by electron microscopy at 3.4 Å resolution. Released 24 Jun 2026.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 5
Atoms: 6,997
Mol. weight: 115.82 kDa
Released: 24 Jun 2026

Explore 23BD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

23BD contains 43 α-helices and 51 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	12-16	5
α-helix	23-25	3
β-strand	38	1	12
β-strand	39-42	4	13
α-helix	43-45	3
α-helix	51-53	3
β-strand	54	1	13
β-strand	60	1	12
α-helix	61-64	4
β-strand	120-122	3	13
α-helix	127-136	10
α-helix	143-144	2
α-helix	145-153	9
α-helix	155	1
β-strand	156-166	11	13
β-strand	213-223	11	13
β-strand	227-230	4	13
α-helix	287-301	15
β-strand	304	1	9
α-helix	306-320	15
α-helix	323-336	14
β-strand	341	1	14
α-helix	343-345	3
α-helix	348-353	6
β-strand	357	1	15
β-strand	362	1	14
β-strand	363	1	15
α-helix	365-378	14
α-helix	383-395	13
α-helix	399-410	12
β-strand	420-421	2	16
α-helix	425-428	4
α-helix	437-445	9
β-strand	448-449	2	16
β-strand	456-457	2	16
α-helix	463-479	17

Chain B: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	106-110	5
α-helix	111-120	10
β-strand	125	1	1
α-helix	131-133	3
β-strand	137-142	6	2
α-helix	150-151	2
α-helix	155-168	14
β-strand	172-175	4	2
α-helix	181-192	12
α-helix	195-197	3
β-strand	203-208	6	2
β-strand	211	1	3
β-strand	215-217	3	3
β-strand	228-230	3	3
α-helix	231-237	7
α-helix	244-246	3
β-strand	251-256	6	2
β-strand	262	1	4
β-strand	266-269	4	5

Chain C: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	291-295	5	9
β-strand	300-304	5	2
β-strand	310	1	4
β-strand	314	1	11
β-strand	320	1	11
α-helix	321-333	13
α-helix	339-349	11
β-strand	361-363	3	2
β-strand	365	1	7
β-strand	370	1	1

Chain D: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	291-294	4	5
β-strand	300-304	5	7
β-strand	313-315	3	10
β-strand	319-320	2	10
α-helix	321-333	13
α-helix	339-349	11
β-strand	361-363	3	7
β-strand	365	1	2
β-strand	370	1	6

Chain E: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	107-110	4
α-helix	111-120	10
β-strand	125	1	6
α-helix	131-133	3
β-strand	138-142	5	7
α-helix	150-151	2
α-helix	155-168	14
β-strand	173-175	3	7
α-helix	181-192	12
α-helix	195-199	5
β-strand	204-208	5	7
β-strand	211-212	2	8
β-strand	215-217	3	8
β-strand	228-230	3	8
α-helix	231-238	8
β-strand	251-255	5	7
β-strand	265-269	5	9
α-helix	278-280	3
β-strand	286-288	3	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caspase-4	B, E	protein	185	Homo sapiens	P49662 (AlphaFold model)
Caspase-4	C, D	protein	88	Homo sapiens	P49662 (AlphaFold model)
Gasdermin-D	A	protein	485	Homo sapiens	P57764 (AlphaFold model)

Sequence of entity 1 (B, E), FASTA

>23BD_1 Caspase-4 (chains B, E)
ALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKE
LLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEK
KPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQAARGANRGELWVRDSPASLEVASSQSSE
NLEED

Sequence of entity 2 (C, D), FASTA

>23BD_2 Caspase-4 (chains C, D)
AVYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQS
FETPRAKAQMPTIERLSMTRYFYLFPGN

Sequence of entity 3 (A), FASTA

>23BD_3 Gasdermin-D (chains A)
SMGSAFERVVRRVVQELDHGGEFIPVTSLQSSTGFQPYCLVVRKPSSSWFWKPRYKCVNL
SIKDILEPDAAEPDVQRGRSFHFYDAMDGQIQGSVELAAPGQAKIAGGAAVSDSSSTSMN
VYSLSVDPNTWQTLLHERHLRQPEHKVLQQLRSRGDNVYVVTEVLQTQKEVEVTRTHKRE
GSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRT
FQPPATGHKRSTSEGAWPQLPSGLSMMRCLHNFLTDGVPAELAFTEDFQGLRAEVETISK
ELELLDRELCQLLLEGLEGVLRDQLALRALEEALEQGQSLGPVEPLDGPAGAVLECLVLS
SGMLVPELAIPVVYLLGALTMLSETQHKLLAEALESQTLLGPLELVGSLLEQSAPWQERS
TMSLPPGLLGNSWGEGAPAWVLLDECGLELGEDTPHVCWEPQAQGRMCALYASLALLSGL
SQEPH

Primary citation

Cryo-EM structures of human caspase-4 in complex with full-length gasdermin D. Luan, Y., Chen, E.B., Mao, Y.D. Structure (2026).

Other PDB entries of the same protein (UniProt P49662 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WR6 1.96 Å, Crystal structure of ADP-riboxanated caspase-4 in complex with Af1521
7WR1 2.13 Å, P32 of caspase-4 C258A mutant in complex with OspC3 C-terminal ankyrin-repeat domain
6NRY 2.18 Å, Crystal structure of human caspase-4
7WR4 2.75 Å, Crystal structure of OspC3-calmodulin-caspase-4 complex
7WR0 2.8 Å, P32 of caspase-4 C258A mutant
7WR5 3.1 Å, Crystal structure of OspC3-calmodulin-caspase-4 complex binding with 2'-aF-NAD+
8J6K 3.12 Å, Crystal structure of pro-interleukin-18 and caspase-4 complex
8SPB 3.2 Å, Caspase-4/Pro-IL-18 complex
23BB 3.6 Å, Caspase-4 p20/p10 and human GSDMD
6KMZ 3.61 Å, caspase-4 P22/P10 C258A in complex with human GSDMD-C domain

Browse structure collections

About this viewer

MolViewer shows 23BD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.