7WR2: OspC3

Cryatal structure of OspC3 C-terminal ankyrin-repeat domain. Determined by X-ray diffraction at 1.54 Å resolution. Released 25 Jan 2023.

Method: X-ray diffraction
Resolution: 1.54 Å
Organism: Shigella flexneri
Chains: 1
Atoms: 1,269
Mol. weight: 18.37 kDa
Released: 25 Jan 2023

Explore 7WR2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7WR2 contains 13 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	348-353	6
α-helix	357-363	7
α-helix	367-379	13
α-helix	383-392	10
α-helix	397-403	7
α-helix	410-414	5
α-helix	417-422	6
α-helix	425-427	3
α-helix	428-436	9
α-helix	444-446	3
α-helix	455-462	8
α-helix	465-473	9
α-helix	478-480	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
OspC3	A	protein	161	Shigella flexneri	A0A0H2US87 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7WR2_1 OspC3 (chains A)
GPLGSGRPMLSTDNFKKIKLRDISLEDAIKASNYEEINNKVTDKKMAHQALAYSLGNKKA
DIALYLLSKFNFTKQDVAEMEKMKNNRYCNLYDVEYLLSKDGANYKVLEYFINNGLVDVN
KKFQKVNSGDTMLDNAMKSKDSKMIDFLLKNGAILGKRFEI

Primary citation

Structural mechanisms of calmodulin activation of Shigella effector OspC3 to ADP-riboxanate caspase-4/11 and block pyroptosis. Hou, Y., Zeng, H., Li, Z. et al. Nat Struct Mol Biol (2023) 30:261-272. DOI 10.1038/s41594-022-00888-3 · PubMed

Other PDB entries of the same protein (UniProt A0A0H2US87 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WR3 1.87 Å, Crystal structure of MBP-fused OspC3 in complex with calmodulin
7WR1 2.13 Å, P32 of caspase-4 C258A mutant in complex with OspC3 C-terminal ankyrin-repeat domain
7WR4 2.75 Å, Crystal structure of OspC3-calmodulin-caspase-4 complex
7WR5 3.1 Å, Crystal structure of OspC3-calmodulin-caspase-4 complex binding with 2'-aF-NAD+
8J6K 3.12 Å, Crystal structure of pro-interleukin-18 and caspase-4 complex

Browse structure collections

About this viewer

MolViewer shows 7WR2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.