7WSP: Membrane protein M

Structure of a membrane protein M. Determined by electron microscopy at 4.09 Å resolution. Released 1 Feb 2023.

Method: Electron microscopy
Resolution: 4.09 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,883
Mol. weight: 112.72 kDa
Released: 1 Feb 2023

Explore 7WSP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7WSP contains 21 α-helices and 87 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	41-44	4	1
β-strand	63-69	7	2
β-strand	79-83	5	2
β-strand	103-109	7	2
β-strand	116-117	2	2
β-strand	121	1	2
β-strand	122-125	4	1
α-helix	138-165	28

Chain B: 9 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	245	1	8
β-strand	251-252	2	9
β-strand	253	1	10
α-helix	254-255	2
β-strand	260	1	9
β-strand	265-275	11	9
β-strand	276	1	8
β-strand	282-286	5	11
β-strand	289-290	2	11
α-helix	291	1
β-strand	295-297	3	9
β-strand	301-303	3	9
β-strand	311-321	11	9
α-helix	322-325	4
β-strand	331-337	7	11
β-strand	340-344	5	11
β-strand	360	1	12
α-helix	363-366	4
β-strand	381-385	5	12
β-strand	392-396	5	13
β-strand	402	1	13
β-strand	418-421	4	12
α-helix	428-433	6
β-strand	437-442	6	13
β-strand	452-454	3	13
β-strand	463	1	14
α-helix	464-465	2
β-strand	466-470	5	15
α-helix	474-478	5
β-strand	485-492	8	15
β-strand	493	1	14
β-strand	500-503	4	16
β-strand	506-507	2	16
β-strand	513-515	3	15
β-strand	528-534	7	15
α-helix	538-541	4
β-strand	548-550	3	16
β-strand	562-564	3	16
α-helix	581-606	26

Chain C: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	47-49	3	3
β-strand	53-56	4	4
β-strand	61-66	6	3
β-strand	75-76	2	5
β-strand	77-78	2	6
β-strand	87-88	2	6
α-helix	89-90	2
β-strand	93	1	3
β-strand	96-101	6	3
β-strand	104-109	6	3
α-helix	114-116	3
β-strand	119-120	2	7
β-strand	122-125	4	5
β-strand	132-134	3	5
β-strand	138-139	2	7
β-strand	140-143	4	4
α-helix	148-180	33

Chain D: 8 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	245	1	17
β-strand	248-252	5	18
β-strand	253	1	10
α-helix	254-255	2
β-strand	260	1	19
β-strand	265-266	2	19
β-strand	269-275	7	18
β-strand	276	1	17
β-strand	281-283	3	20
β-strand	286	1	21
β-strand	295-297	3	18
β-strand	301-302	2	18
β-strand	312-318	7	18
β-strand	320-321	2	19
α-helix	322-326	5
β-strand	331-332	2	21
β-strand	334-337	4	20
β-strand	340-342	3	20
β-strand	345-346	2	21
β-strand	360-362	3	22
α-helix	369-373	5
β-strand	377-382	6	22
β-strand	392-396	5	23
α-helix	404-406	3
β-strand	412	1	24
β-strand	418	1	24
β-strand	422-425	4	22
β-strand	438-442	5	23
β-strand	463	1	25
β-strand	466-470	5	26
α-helix	474-479	6
β-strand	484-492	9	26
β-strand	493	1	25
β-strand	501-502	2	27
β-strand	503	1	28
β-strand	506	1	28
α-helix	507-509	3
β-strand	514-515	2	26
β-strand	519	1	26
β-strand	528-535	8	26
α-helix	538-541	4
β-strand	548-549	2	27
β-strand	563	1	27
α-helix	576-606	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell antigen receptor complex-associated protein alpha chain	A	protein	137	Homo sapiens	P11912 (AlphaFold model)
B-cell antigen receptor complex-associated protein beta chain	C	protein	139	Homo sapiens	P40259 (AlphaFold model)
Isoform 2 of Immunoglobulin heavy constant mu	B	protein	366	Homo sapiens	P01871 (AlphaFold model)
Isoform 2 of Immunoglobulin heavy constant mu	D	protein	367	Homo sapiens	P01871 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7WSP_1 B-cell antigen receptor complex-associated protein alpha chain (chains A)
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLI
IQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIIL
LFCAVVPGTLLLFRKRW

Sequence of entity 2 (C), FASTA

>7WSP_2 B-cell antigen receptor complex-associated protein beta chain (chains C)
SRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNES
LATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIM
IQTLLIILFIIVPIFLLLD

Sequence of entity 3 (B), FASTA

>7WSP_3 Isoform 2 of Immunoglobulin heavy constant mu (chains B)
IAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQVGSGVTTDQVQ
AEAKESGPTTYKVTSTLTIKESDWLGQSMFTCRVDHRGLTFQQNASSMCVPDQDTAIRVF
AIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSAV
GEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRE
SATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTVSEEEW
NTGETYTCVVAHEALPNRVTERTVDKSTEGEVSADEEGFENLWATASTFIVLFLLSLFYS
TTVTLF

Sequence of entity 4 (D), FASTA

>7WSP_4 Isoform 2 of Immunoglobulin heavy constant mu (chains D)
IAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQVGSGVTTDQVQ
AEAKESGPTTYKVTSTLTIKESDWLGQSMFTCRVDHRGLTFQQNASSMCVPDQDTAIRVF
AIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSAV
GEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRE
SATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTVSEEEW
NTGETYTCVVAHEALPNRVTERTVDKSTEGEVSADEEGFENLWATASTFIVLFLLSLFYS
TTVTLFK

Primary citation

Structure of a membrane protein M. Ma, X., Zhu, Y., Chen, Y. et al. To be published.

Other PDB entries of the same protein (UniProt P11912 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WSO 3.03 Å, Structure of a membrane protein G
7XQ8 3.3 Å, Structure of human B-cell antigen receptor of the IgM isotype
7XT6 3.63 Å, Structure of a membrane protein M3
9E6G 4.4 Å, Locally Refined Cryo-EM map of 2G12 IgG BCR receptor lacking Fab region view
1CV9 NMR study of itam peptide substrate

Browse structure collections

About this viewer

MolViewer shows 7WSP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.