7X0S: Human TRiC-tubulin-S3

Human TRiC-tubulin-S3. Determined by electron microscopy at 3.1 Å resolution. Released 12 Apr 2023.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 17
Atoms: 68,346
Mol. weight: 1005 kDa
Ligands: MG, AF3, ADP
Released: 12 Apr 2023

Explore 7X0S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7X0S contains 394 α-helices and 433 β-strands across 17 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 23 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	128
β-strand	10-12	3	129
α-helix	15-32	18
α-helix	33-35	3
β-strand	42	1	116
β-strand	43-47	5	107
β-strand	52-55	4	107
α-helix	58-64	7
α-helix	70-85	16
α-helix	92-108	17
α-helix	114-132	19
α-helix	146-156	11
α-helix	167-176	10
β-strand	181-183	3	130
β-strand	187-189	3	130
α-helix	192-194	3
β-strand	197-201	5	131
α-helix	205-207	3
β-strand	209-211	3	131
β-strand	213-216	4	132
β-strand	228-232	5	132
β-strand	234-237	4	133
β-strand	250-252	3	125
β-strand	253-254	2	114
α-helix	257-259	3
α-helix	260-277	18
β-strand	285-288	4	133
α-helix	298-303	6
β-strand	306-309	4	133
α-helix	313-323	11
β-strand	328	1	133
α-helix	342-344	3
β-strand	348-355	8	132
β-strand	360-365	6	132
β-strand	374-379	6	131
α-helix	382-404	23
β-strand	408-410	3	134
α-helix	414-429	16
α-helix	435-445	11
α-helix	447-455	9
α-helix	463-476	14
β-strand	486	1	135
β-strand	489	1	136
β-strand	494	1	136
β-strand	497	1	135
α-helix	498-501	4
β-strand	504-506	3	134
α-helix	508-524	17
β-strand	529-532	4	129
α-helix	533-535	3

Chain A: 24 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	52
β-strand	10-12	3	51
α-helix	15-32	18
α-helix	33-35	3
β-strand	42-47	6	30
β-strand	52-55	4	30
α-helix	58-64	7
α-helix	70-85	16
α-helix	92-108	17
α-helix	114-132	19
α-helix	145-156	12
α-helix	167-176	10
β-strand	181-183	3	67
β-strand	187-189	3	67
α-helix	192-194	3
β-strand	197-201	5	68
α-helix	205-207	3
β-strand	209-211	3	68
β-strand	213-216	4	69
β-strand	228-232	5	69
β-strand	234-237	4	70
β-strand	241	1	71
β-strand	250-252	3	48
β-strand	253-254	2	38
α-helix	257-259	3
α-helix	260-277	18
β-strand	285-288	4	70
β-strand	292	1	71
α-helix	298-303	6
β-strand	306-308	3	70
α-helix	313-323	11
β-strand	328	1	70
α-helix	342-344	3
β-strand	348-355	8	69
β-strand	360-365	6	69
β-strand	374-379	6	68
α-helix	382-404	23
β-strand	408-410	3	72
α-helix	414-429	16
α-helix	435-445	11
α-helix	447-455	9
α-helix	463-476	14
α-helix	483-485	3
β-strand	486	1	73
β-strand	489	1	74
β-strand	494	1	74
β-strand	497	1	73
α-helix	498-501	4
β-strand	504-506	3	72
α-helix	508-524	17
β-strand	529-532	4	51
α-helix	533-535	3

Chain B: 23 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	42
β-strand	17-20	4	41
α-helix	24-36	13
α-helix	39-42	4
β-strand	49-53	5	60
β-strand	62-64	3	60
α-helix	67-74	8
α-helix	81-94	14
α-helix	99-115	17
α-helix	123-143	21
β-strand	146	1	61
α-helix	152-166	15
α-helix	167-169	3
α-helix	179-188	10
β-strand	199-205	7	62
α-helix	209-211	3
β-strand	213-214	2	62
β-strand	219-220	2	63
β-strand	237-240	4	64
β-strand	254-258	5	48
α-helix	261-282	22
α-helix	283-285	3
β-strand	289-292	4	64
α-helix	298-306	9
β-strand	312-313	2	64
α-helix	319-327	9
α-helix	338-340	3
β-strand	348	1	65
β-strand	351-353	3	63
β-strand	358-361	4	63
β-strand	363	1	65
β-strand	371-377	7	62
α-helix	380-400	21
β-strand	406-408	3	61
α-helix	412-425	14
α-helix	430-443	14
α-helix	445-454	10
α-helix	458-469	12
β-strand	476-479	4	66
β-strand	484-487	4	66
α-helix	488-491	4
β-strand	494-496	3	61
α-helix	497-515	19
β-strand	517-522	6	41
α-helix	524-525	2

Chain e: 21 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	100
α-helix	20-22	3
β-strand	23	1	117
β-strand	26	1	99
α-helix	31-46	16
α-helix	54-55	2
β-strand	56-60	5	118
β-strand	66-69	4	118
α-helix	72-77	6
β-strand	81	1	119
α-helix	84-99	16
α-helix	106-123	18
α-helix	128-146	19
α-helix	161-171	11
α-helix	177-179	3
α-helix	182-192	11
β-strand	196	1	120
β-strand	201	1	120
β-strand	207-214	8	121
α-helix	217-219	3
β-strand	221-223	3	121
β-strand	229	1	122
β-strand	240-241	2	122
β-strand	244-249	6	123
β-strand	253	1	124
β-strand	261	1	84
β-strand	264-265	2	125
α-helix	269-291	23
β-strand	297-300	4	123
β-strand	304	1	124
α-helix	306-314	9
β-strand	319-320	2	123
α-helix	325-334	10
β-strand	340	1	123
β-strand	352-354	3	123
β-strand	357-360	4	122
β-strand	369-372	4	122
β-strand	381-387	7	121
α-helix	390-412	23
β-strand	416-418	3	126
α-helix	422-434	13
α-helix	443-453	11
α-helix	455-463	9
α-helix	468-481	14
β-strand	487	1	127
β-strand	498	1	127
α-helix	499-502	4
β-strand	505-507	3	126
α-helix	508-526	19
β-strand	528-532	5	99
β-strand	534	1	117

Chain E: 22 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	23
α-helix	20-22	3
β-strand	23	1	40
β-strand	26	1	22
α-helix	30-47	18
α-helix	54-55	2
β-strand	56-60	5	41
β-strand	66-69	4	41
α-helix	72-77	6
β-strand	81	1	42
α-helix	86-99	14
α-helix	106-123	18
α-helix	128-146	19
α-helix	161-171	11
α-helix	177-179	3
α-helix	182-192	11
β-strand	196	1	43
β-strand	201	1	43
β-strand	207-214	8	44
α-helix	217-219	3
β-strand	221-223	3	44
β-strand	229	1	45
β-strand	232	1	46
β-strand	240-241	2	45
β-strand	244-249	6	46
β-strand	253	1	47
β-strand	261	1	8
β-strand	264-265	2	48
α-helix	269-291	23
β-strand	297-300	4	46
β-strand	304	1	47
α-helix	306-314	9
β-strand	319-320	2	46
α-helix	325-334	10
β-strand	340	1	46
α-helix	348-350	3
β-strand	352-354	3	46
β-strand	357-360	4	45
β-strand	369-372	4	45
β-strand	381-387	7	44
α-helix	390-412	23
β-strand	416-418	3	49
α-helix	422-434	13
α-helix	443-453	11
α-helix	455-463	9
α-helix	468-481	14
β-strand	487	1	50
β-strand	498	1	50
α-helix	499-502	4
β-strand	505-507	3	49
α-helix	508-526	19
β-strand	528-532	5	22
β-strand	534	1	40

Chain G: 25 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	15-18	4	30
α-helix	20-23	4
α-helix	25-34	10
β-strand	47	1	11
β-strand	48-51	4	1
β-strand	57-60	4	1
α-helix	63-67	5
α-helix	75-90	16
α-helix	96-107	12
α-helix	109-113	5
α-helix	119-137	19
β-strand	142-143	2	31
α-helix	149-160	12
α-helix	164-166	3
α-helix	169-183	15
β-strand	184-185	2	32
β-strand	192-193	2	32
β-strand	200-205	6	33
α-helix	209-211	3
β-strand	213-215	3	33
β-strand	218-220	3	34
β-strand	232-233	2	34
β-strand	238-240	3	35
β-strand	241	1	36
β-strand	245	1	37
β-strand	255-256	2	38
β-strand	258	1	7
α-helix	262-282	21
β-strand	289-291	3	35
β-strand	296	1	37
α-helix	298-306	9
β-strand	310-312	3	35
α-helix	317-326	10
β-strand	332	1	36
α-helix	335-337	3
α-helix	340-342	3
β-strand	343-344	2	35
β-strand	350-354	5	34
β-strand	359-363	5	34
β-strand	373-378	6	33
α-helix	381-403	23
β-strand	406-408	3	31
α-helix	413-425	13
α-helix	426-428	3
α-helix	434-443	10
α-helix	446-455	10
α-helix	461-469	9
β-strand	478	1	39
β-strand	489	1	39
α-helix	490-493	4
β-strand	497-498	2	31
α-helix	499-517	19
β-strand	519-526	8	30

Chain H: 22 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	14-17	4	12
α-helix	19-32	14
α-helix	33-35	3
β-strand	46-50	5	22
β-strand	56-59	4	22
α-helix	62-65	4
β-strand	71	1	23
α-helix	77-89	13
α-helix	95-106	12
α-helix	109-112	4
α-helix	119-137	19
β-strand	141	1	24
α-helix	149-162	14
α-helix	172-183	12
α-helix	192-194	3
β-strand	195-201	7	25
α-helix	205-207	3
β-strand	209-211	3	25
β-strand	215-216	2	26
β-strand	232	1	26
β-strand	237-240	4	27
β-strand	244	1	28
β-strand	253-255	3	8
α-helix	260-281	22
β-strand	288-291	4	27
β-strand	295	1	28
α-helix	297-305	9
β-strand	309-311	3	27
α-helix	316-326	11
β-strand	330-331	2	27
α-helix	334-336	3
β-strand	347-351	5	26
β-strand	358-362	5	26
β-strand	370-376	7	25
α-helix	379-401	23
β-strand	405-407	3	24
α-helix	412-424	13
α-helix	432-440	9
α-helix	441-443	3
α-helix	444-451	8
α-helix	457-470	14
β-strand	475-477	3	29
β-strand	484-486	3	29
β-strand	493-495	3	24
α-helix	496-513	18
β-strand	516-521	6	12

Chain I: 22 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	33-47	15
α-helix	49-51	3
β-strand	59-62	4	51
β-strand	69-71	3	51
α-helix	74-81	8
β-strand	83	1	52
α-helix	89-101	13
α-helix	108-123	16
α-helix	130-151	22
β-strand	153-154	2	53
α-helix	160-171	12
α-helix	175-179	5
α-helix	183-189	7
α-helix	205-207	3
β-strand	208-212	5	54
β-strand	215	1	55
α-helix	218-220	3
β-strand	222	1	54
β-strand	233	1	56
β-strand	240-244	5	57
β-strand	246-249	4	56
β-strand	253	1	58
β-strand	261-266	6	48
α-helix	273-291	19
β-strand	297-301	5	56
β-strand	309	1	58
α-helix	311-319	9
β-strand	323-328	6	56
α-helix	333-339	7
β-strand	345	1	56
α-helix	348-350	3
α-helix	353-355	3
β-strand	359-366	8	57
β-strand	372-377	6	57
β-strand	386-390	5	54
β-strand	392	1	55
α-helix	395-417	23
β-strand	420-423	4	53
α-helix	427-441	15
α-helix	447-456	10
α-helix	460-468	9
α-helix	473-486	14
β-strand	491-494	4	59
β-strand	499-502	4	59
β-strand	509-511	3	53
α-helix	512-529	18
β-strand	532-537	6	60

9 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-complex protein 1 subunit zeta	K, z	protein	531	Homo sapiens	P40227 (AlphaFold model)
T-complex protein 1 subunit theta	J, P	protein	548	Homo sapiens	P50990 (AlphaFold model)
T-complex protein 1 subunit eta	H, O	protein	543	Homo sapiens	Q99832 (AlphaFold model)
T-complex protein 1 subunit gamma	G, N	protein	545	Homo sapiens	P49368 (AlphaFold model)
T-complex protein 1 subunit epsilon	E, e	protein	539	Homo sapiens	P48643
T-complex protein 1 subunit delta	I, M	protein	539	Homo sapiens	P50991
T-complex protein 1 subunit beta	B, L	protein	535	Homo sapiens	P78371
T-complex protein 1 subunit alpha	A, a	protein	556	Homo sapiens	P17987
Tubulin beta chain	R	protein	444	Homo sapiens	P07437

Sequence of entity 1 (K, z), FASTA

>7X0S_1 T-complex protein 1 subunit zeta (chains K, z)
MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDG
NVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIIT
EGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIK
KQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYE
KTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRKVCGDSDKGFVVINQKGIDPF
SLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLVYEYTLGEEKF
TFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAE
ALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVD
LNTGEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG

Sequence of entity 2 (J, P), FASTA

>7X0S_2 T-complex protein 1 subunit theta (chains J, P)
MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHL
EKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLR
IGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLA
KLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIA
VYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADM
ALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQV
VVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELA
KQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGL
DIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
DWDDDQND

Sequence of entity 3 (H, O), FASTA

>7X0S_3 T-complex protein 1 subunit eta (chains H, O)
MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISN
DGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQI
IIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVV
DAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALL
NVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVSSKLPIGDVAT
QYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNF
FTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYL
RDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDIN
NEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGRG
RPH

Sequence of entity 4 (G, N), FASTA

>7X0S_4 T-complex protein 1 subunit gamma (chains G, N)
MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMT
NDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPT
VVISAYRKALDDMISTLKKISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAV
KMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVL
LDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLA
QHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYF
TFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH
ALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGV
NGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAP
DAGQE

Sequence of entity 5 (E, e), FASTA

>7X0S_5 T-complex protein 1 subunit epsilon (chains E, e)
SMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMV
DKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQ
LLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCH
RQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKK
VEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAIC
QWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEI
SFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGG
GAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQV
KEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE

Sequence of entity 6 (I, M), FASTA

>7X0S_6 T-complex protein 1 subunit delta (chains I, M)
MPENVAPRSGATAGAAGGRGKGAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKM
IQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSC
TKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYS
SLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVSNSGITR
VEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLI
QKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAE
LAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRA
LIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTEL
RNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR

Sequence of entity 7 (B, L), FASTA

>7X0S_7 T-complex protein 1 subunit beta (chains B, L)
MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAS
LMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKK
IHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFT
KLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIA
NTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYP
EQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLI
HFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHA
VTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDM
REGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC

Sequence of entity 8 (A, a), FASTA

>7X0S_8 T-complex protein 1 subunit alpha (chains A, a)
MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGAT
ILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISG
YRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIK
YTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFS
LQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYF
VEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDE
LILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALS
IYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPER
KNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDD
KHGSYEDAVHSGALND

Sequence of entity 9 (R), FASTA

>7X0S_9 Tubulin beta chain (chains R)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEEDFGEEAEEEA

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	16
AF3	Aluminum fluoride	Al F3	16
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	16

Primary citation

Pathway and mechanism of tubulin folding mediated by TRiC/CCT along its ATPase cycle revealed using cryo-EM. Liu, C., Jin, M., Wang, S. et al. Commun Biol (2023) 6:531-531. DOI 10.1038/s42003-023-04915-x · PubMed

Other PDB entries of the same protein (UniProt P40227 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NVL 2.5 Å, Human TRiC complex in closed state with nanobody bound (Consensus Map)
8SH9 2.7 Å, CCT G beta 5 complex best PhLP1 class
9S72 2.71 Å, Human CCT in Closed Conformation
8SHE 2.8 Å, CCT-G beta 5 complex closed state 8
8SHG 2.8 Å, CCT G beta 5 complex closed state 9
8SHN 2.8 Å, CCT-G beta 5 complex closed state 6
7TTT 2.9 Å, The beta-tubulin folding intermediate III
8SG9 2.9 Å, CCT G beta 5 complex closed state 3
8SGC 2.9 Å, CCT G beta 5 complex closed state 2
8SGL 2.9 Å, CCT G beta 5 complex closed state 15
8SHD 2.9 Å, CCT G beta 5 complex closed state 10
8SHQ 2.9 Å, CCT G beta 5 complex closed state 12

Browse structure collections

About this viewer

MolViewer shows 7X0S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.