7X5E: Nrf2-MafG heterodimer

Nrf2-MafG heterodimer bound with CsMBE1. Determined by X-ray diffraction at 2.3 Å resolution. Released 9 Nov 2022.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Homo sapiens, synthetic construct
Chains: 8
Atoms: 4,779
Mol. weight: 70.53 kDa
Released: 9 Nov 2022

Explore 7X5E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7X5E contains 14 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	26-30	5
α-helix	34-37	4
α-helix	46-120	75

Chains B and F: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	456-463	8
α-helix	470-475	6
α-helix	478-485	8
α-helix	492-556	65

Chain E: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	26-30	5
α-helix	34-41	8
α-helix	46-118	73

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor MafG	A, E	protein	104	Homo sapiens	O15525 (AlphaFold model)
Nuclear factor erythroid 2-related factor 2	B, F	protein	113	Homo sapiens	Q16236 (AlphaFold model)
DNA (5'-d(gptptpgpcptpgpapcptpcpaptpcpapt)-3')	C, G	DNA	16	synthetic construct
DNA (5'-d(cpaptpgpaptpgpapgptpcpapgpcpapa)-3')	D, H	DNA	16	synthetic construct

Sequence of entity 1 (A, E), FASTA

>7X5E_1 Transcription factor MafG (chains A, E)
MGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRVKRVTQKEEL
EKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVAR

Sequence of entity 2 (B, F), FASTA

>7X5E_2 Nuclear factor erythroid 2-related factor 2 (chains B, F)
GPHMAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRGKN
KVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTL

Sequence of entity 3 (C, G), FASTA

>7X5E_3 DNA (5'-D(*GP*TP*TP*GP*CP*TP*GP*AP*CP*TP*CP*AP*TP*CP*AP*T)-3') (chains C, G)
GTTGCTGACTCATCAT

Sequence of entity 4 (D, H), FASTA

>7X5E_4 DNA (5'-D(*CP*AP*TP*GP*AP*TP*GP*AP*GP*TP*CP*AP*GP*CP*AP*A)-3') (chains D, H)
CATGATGAGTCAGCAA

Primary citation

Structural basis of transcription regulation by CNC family transcription factor, Nrf2. Sengoku, T., Shiina, M., Suzuki, K. et al. Nucleic Acids Res (2022) 50:12543-12557. DOI 10.1093/nar/gkac1102 · PubMed

Other PDB entries of the same protein (UniProt O15525 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7X5G 2.3 Å, Nrf2 (A510Y)-MafG heterodimer bound with CsMBE2
7X5F 2.6 Å, Nrf2-MafG heterodimer bound with CsMBE2

Browse structure collections

About this viewer

MolViewer shows 7X5E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.