Crystal structure of human RIPK1 kinase domain in complex with compound SKLB923. Determined by X-ray diffraction at 2.38 Å resolution. Released 26 Apr 2023.
Explore 7XMK in 3D Show helices and sheets RCSB PDB PDBe
7XMK contains 35 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11 | 1 | 1 |
| α-helix | 14-16 | 3 | |
| β-strand | 17 | 1 | 1 |
| β-strand | 31-36 | 6 | 1 |
| β-strand | 40-48 | 9 | 1 |
| α-helix | 54-56 | 3 | |
| α-helix | 57-68 | 12 | |
| β-strand | 75 | 1 | 2 |
| α-helix | 76-77 | 2 | |
| β-strand | 78-83 | 6 | 1 |
| β-strand | 88-92 | 5 | 1 |
| β-strand | 99 | 1 | 2 |
| α-helix | 100-105 | 6 | |
| α-helix | 112-131 | 20 | |
| α-helix | 141-143 | 3 | |
| β-strand | 144-146 | 3 | 2 |
| β-strand | 152-154 | 3 | 2 |
| α-helix | 163-170 | 8 | |
| α-helix | 195-197 | 3 | |
| α-helix | 203-205 | 3 | |
| α-helix | 207-223 | 17 | |
| α-helix | 234-243 | 10 | |
| α-helix | 249-251 | 3 | |
| α-helix | 258-267 | 10 | |
| α-helix | 272-274 | 3 | |
| α-helix | 276-277 | 2 | |
| α-helix | 278-288 | 11 | |
| α-helix | 289-293 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11 | 1 | 3 |
| α-helix | 14-16 | 3 | |
| β-strand | 17-22 | 6 | 3 |
| β-strand | 32-36 | 5 | 3 |
| β-strand | 40-46 | 7 | 3 |
| α-helix | 57-67 | 11 | |
| β-strand | 75 | 1 | 4 |
| α-helix | 76-77 | 2 | |
| β-strand | 78-84 | 7 | 3 |
| β-strand | 87-93 | 7 | 3 |
| β-strand | 99 | 1 | 4 |
| α-helix | 100-105 | 6 | |
| α-helix | 112-131 | 20 | |
| α-helix | 141-143 | 3 | |
| β-strand | 144-146 | 3 | 4 |
| β-strand | 152-154 | 3 | 4 |
| α-helix | 163-167 | 5 | |
| α-helix | 195-197 | 3 | |
| α-helix | 204-205 | 2 | |
| α-helix | 207-223 | 17 | |
| α-helix | 235-243 | 9 | |
| α-helix | 249-251 | 3 | |
| α-helix | 258-267 | 10 | |
| α-helix | 272-274 | 3 | |
| α-helix | 276-277 | 2 | |
| α-helix | 278-288 | 11 | |
| α-helix | 289-293 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Receptor-interacting serine/threonine-protein kinase 1 | A, B | protein | 294 | Homo sapiens | Q13546 (AlphaFold model) |
>7XMK_1 Receptor-interacting serine/threonine-protein kinase 1 (chains A, B) MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLAFHRTQGLMIMKTVYKGPNCIEHNEAL LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL EIIEGMAYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAIAEQQLIMA IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLE
| ID | Name | Formula | Copies |
|---|---|---|---|
| GO4 | 5-[2-(cyclopropylcarbonylamino)-[1,2,4]triazolo[1,5-a]pyridin-7-yl]-N-[(1S)-1-(… | C28 H25 F N6 O2 | 2 |
Water and common crystallization additives (IOD) are not listed.
From Hit to Lead: Structure-Based Optimization of Novel Selective Inhibitors of Receptor-Interacting Protein Kinase 1 (RIPK1) for the Treatment of Inflammatory Diseases. Zhang, L., Li, Y., Tian, C. et al. J Med Chem (2024) 67:754-773. DOI 10.1021/acs.jmedchem.3c02102 · PubMed
Other PDB entries of the same protein (UniProt Q13546 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7XMK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.