Cryo-EM structure of Arf6 helical polymer assembled on lipid membrane. Determined by electron microscopy at 3.9 Å resolution. Released 15 Nov 2023.
Explore 7XRD in 3D Show helices and sheets RCSB PDB PDBe
7XRD contains 36 α-helices and 37 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-20 | 9 | 1 |
| α-helix | 26-35 | 10 | |
| β-strand | 38-39 | 2 | 2 |
| β-strand | 46 | 1 | 3 |
| β-strand | 47-53 | 7 | 1 |
| β-strand | 57-64 | 8 | 1 |
| α-helix | 68-77 | 10 | |
| β-strand | 83-89 | 7 | 1 |
| α-helix | 93-95 | 3 | |
| α-helix | 96-107 | 12 | |
| α-helix | 111-114 | 4 | |
| β-strand | 116-122 | 7 | 1 |
| α-helix | 129-131 | 3 | |
| α-helix | 132-139 | 8 | |
| α-helix | 141-143 | 3 | |
| β-strand | 149-153 | 5 | 1 |
| β-strand | 155 | 1 | 4 |
| β-strand | 160 | 1 | 4 |
| α-helix | 162-171 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-19 | 8 | 3 |
| α-helix | 26-34 | 9 | |
| β-strand | 39 | 1 | 5 |
| β-strand | 47-53 | 7 | 3 |
| β-strand | 57-64 | 8 | 3 |
| α-helix | 68-77 | 10 | |
| β-strand | 83-89 | 7 | 3 |
| α-helix | 93-95 | 3 | |
| α-helix | 96-107 | 12 | |
| α-helix | 111-114 | 4 | |
| β-strand | 116-122 | 7 | 3 |
| α-helix | 129-131 | 3 | |
| α-helix | 132-139 | 8 | |
| α-helix | 141-143 | 3 | |
| β-strand | 149-153 | 5 | 3 |
| β-strand | 155 | 1 | 6 |
| β-strand | 160 | 1 | 6 |
| α-helix | 162-171 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-19 | 8 | 7 |
| α-helix | 26-34 | 9 | |
| β-strand | 39-40 | 2 | 2 |
| β-strand | 47-53 | 7 | 7 |
| β-strand | 57-64 | 8 | 7 |
| α-helix | 68-77 | 10 | |
| β-strand | 83-89 | 7 | 7 |
| α-helix | 93-95 | 3 | |
| α-helix | 96-107 | 12 | |
| α-helix | 111-114 | 4 | |
| β-strand | 116-122 | 7 | 7 |
| α-helix | 129-131 | 3 | |
| α-helix | 132-138 | 7 | |
| α-helix | 141-143 | 3 | |
| β-strand | 149-153 | 5 | 7 |
| β-strand | 155 | 1 | 8 |
| β-strand | 160 | 1 | 8 |
| α-helix | 162-171 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-20 | 9 | 9 |
| α-helix | 26-35 | 10 | |
| β-strand | 39 | 1 | 5 |
| β-strand | 47-53 | 7 | 9 |
| β-strand | 57-64 | 8 | 9 |
| α-helix | 68-77 | 10 | |
| β-strand | 83-89 | 7 | 9 |
| α-helix | 96-107 | 12 | |
| α-helix | 111-114 | 4 | |
| α-helix | 115 | 1 | |
| β-strand | 116-122 | 7 | 9 |
| α-helix | 129-131 | 3 | |
| α-helix | 132-139 | 8 | |
| α-helix | 141-143 | 3 | |
| β-strand | 149-153 | 5 | 9 |
| β-strand | 155 | 1 | 10 |
| β-strand | 160 | 1 | 10 |
| α-helix | 162-171 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ADP-ribosylation factor 6 | A, B, C, D | protein | 182 | Homo sapiens | P62330 (AlphaFold model) |
>7XRD_1 ADP-ribosylation factor 6 (chains A, B, C, D) GKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNV WDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFA NKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKSLEHHHH HH
Structural elucidation of how ARF small GTPases induce membrane tubulation for vesicle fission. Pang, X., Zhang, Y., Park, K. et al. Proc Natl Acad Sci U S A (2025) 122:e2417820122-e2417820122. DOI 10.1073/pnas.2417820122 · PubMed
Other PDB entries of the same protein (UniProt P62330 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7XRD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.