Crystal structure of spFft3 N-terminal truncation. Determined by X-ray diffraction at 2.25 Å resolution. Released 6 Dec 2023.
Explore 7XWY in 3D Show helices and sheets RCSB PDB PDBe
7XWY contains 28 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 234-247 | 14 | |
| α-helix | 250-257 | 8 | |
| α-helix | 261-269 | 9 | |
| α-helix | 276-280 | 5 | |
| α-helix | 284-289 | 6 | |
| α-helix | 302-341 | 40 | |
| α-helix | 349-351 | 3 | |
| β-strand | 354 | 1 | 1 |
| α-helix | 360-365 | 6 | |
| α-helix | 377-378 | 2 | |
| α-helix | 386-388 | 3 | |
| α-helix | 389-403 | 15 | |
| β-strand | 407-410 | 4 | 1 |
| α-helix | 412-413 | 2 | |
| α-helix | 418-431 | 14 | |
| β-strand | 438-442 | 5 | 1 |
| α-helix | 444-446 | 3 | |
| α-helix | 447-457 | 11 | |
| β-strand | 463-465 | 3 | 1 |
| α-helix | 470-481 | 12 | |
| β-strand | 489-493 | 5 | 1 |
| α-helix | 494-498 | 5 | |
| α-helix | 501-510 | 10 | |
| β-strand | 512-518 | 7 | 1 |
| α-helix | 521-524 | 4 | |
| α-helix | 529-536 | 8 | |
| β-strand | 539-545 | 7 | 1 |
| α-helix | 549-551 | 3 | |
| α-helix | 554-564 | 11 | |
| α-helix | 574-576 | 3 | |
| α-helix | 577-581 | 5 | |
| α-helix | 590-592 | 3 | |
| α-helix | 594-607 | 14 | |
| α-helix | 608-610 | 3 | |
| β-strand | 611-612 | 2 | 1 |
| α-helix | 616-619 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ATP-dependent helicase fft3 | A | protein | 389 | Schizosaccharomyces pombe 972h- | O42861 (AlphaFold model) |
>7XWY_1 ATP-dependent helicase fft3 (chains A) IDTAALKEEVLKYMNRCSTQDLADMTGCTLAEAEFMVAKRPFPDLESALVVKQPRPVIPK GRRGRREKTPLGPRLVGICMEIMRGYFVVDALIRQCEQLGGKIQRGIEAWGLSNTATSDE GETSLVNFDQMKSFGTPANSSFITTPPASFSPDIKLQDYQIIGINWLYLLYELKLAGILA DEMGLGKTCQTIAFFSLLMDKNINGPHLVIAPASTMENWLREFAKFCPKLKIELYYGSQV EREEIRERINSNKDSYNVMLTTYRLAATSKADRLFLRNQKFNVCVYDEGHYLKNRASERY RHLMSIPADFRVLLTGTPLQNNLKELISLLAFILPHVFDYGLKSLDVIFTMKKSPESDFE RALLSEQRVSRAKMMMAPFVLRRKKSQVL
Crystal structure of spFft3 N-terminal truncation. Zhang, N., Jiang, T., Huo, Y. To be published.
Other PDB entries of the same protein (UniProt O42861 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7XWY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.