7Y3A: TRIM7

Crystal structure of TRIM7 bound to 2C. Determined by X-ray diffraction at 1.7 Å resolution. Released 3 Aug 2022.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,053
Mol. weight: 63.76 kDa
Released: 3 Aug 2022

Explore 7Y3A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Y3A contains 5 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 16 β-strands

Element	Residues	Length	Sheet
β-strand	346	1	1
β-strand	355-357	3	2
β-strand	363-366	4	2
β-strand	385-387	3	3
β-strand	388	1	1
β-strand	392	1	3
β-strand	396-403	8	2
β-strand	409-415	7	3
α-helix	428-430	3
β-strand	432-438	7	3
β-strand	441-444	4	3
β-strand	451-453	3	3
β-strand	460-466	7	2
β-strand	471-476	6	2
β-strand	481-487	7	2
β-strand	494-500	7	3
β-strand	507-510	4	2

Chain B: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	346	1	7
β-strand	355-357	3	8
β-strand	363-366	4	8
β-strand	385-387	3	9
β-strand	388	1	7
β-strand	392	1	9
β-strand	396-403	8	8
β-strand	409-415	7	9
α-helix	428-430	3
β-strand	432-438	7	9
β-strand	441-444	4	9
β-strand	451-452	2	9
β-strand	460-466	7	8
β-strand	471-476	6	8
β-strand	481-487	7	8
β-strand	494-500	7	9
β-strand	506-511	6	8
α-helix	526-529	4

Chain C: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	346	1	4
β-strand	355-357	3	5
β-strand	363-366	4	5
β-strand	385-387	3	6
β-strand	388	1	4
β-strand	392	1	6
β-strand	396-403	8	5
β-strand	409-415	7	6
α-helix	428-430	3
β-strand	432-438	7	6
β-strand	441-444	4	6
β-strand	451-453	3	6
β-strand	460-466	7	5
β-strand	471-476	6	5
β-strand	481-487	7	5
β-strand	494-500	7	6
β-strand	507-511	5	5
α-helix	523-526	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase TRIM7,E3 ubiquitin-protein ligase TRIM7,E3 ubiquitin-protein ligase…	A, B, C	protein	193	Homo sapiens	Q9C029 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>7Y3A_1 E3 ubiquitin-protein ligase TRIM7,E3 ubiquitin-protein ligase TRIM7,E3 ubiquitin-protein ligase TRIM7,TRIM7-2C (chains A, B, C)
KEEKVTLTLDPDTANPRLILSLDLKGVRLGERAQDLPNHPCRFDTNTRVLASCGFSSGRH
HWEVEVGSKDGWAFGVARESVRRKGLTPFTPEEGVWALQLNGGQYWAVTSPERSPLSCGH
LSRVRVALDLEVGAVSFYAVEDMRHLYTFRVNFQERVFPLFSVCSTGTYLRIWPGGSGGS
GGSGGATLEALFQ

Primary citation

C-terminal glutamine acts as a C-degron targeted by E3 ubiquitin ligase TRIM7. Ru, Y., Yan, X., Zhang, B. et al. Proc Natl Acad Sci U S A (2022) 119:e2203218119-e2203218119. DOI 10.1073/pnas.2203218119 · PubMed

Other PDB entries of the same protein (UniProt Q9C029 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7W0Q 1.1 Å, TRIM7 in complex with C-terminal peptide of 2C
7X70 1.25 Å, TRIM7 in complex with C-terminal peptide of NSP8
7X6Y 1.39 Å, TRIM7 in complex with C-terminal peptide of NSP5
7W0S 1.4 Å, TRIM7 in complex with C-terminal peptide of 2C
7X6Z 1.43 Å, TRIM7 in complex with C-terminal peptide of NSP12
9HIN 1.55 Å, Crystal structure of human TRIM7 PRYSPRY domain bound to…
7W0T 1.57 Å, TRIM7 in complex with C-terminal peptide of 2C
6UMA 1.6 Å, Crystal structure of the TRIM7 B30.2 domain at 1.6 angstrom resolution
8R5B 1.6 Å, Crystal structure of human TRIM7 PRYSPRY domain bound to (3-phenoxybenzoyl)-L-glutamine
8R5C 1.6 Å, Crystal structure of human TRIM7 PRYSPRY domain bound to…
8A5L 1.62 Å, TRIM7 PRYSPRY in complex with a 2BC peptide TIEALFQ
7OVX 1.7 Å, E3 RING ligase binding domain

Browse structure collections

About this viewer

MolViewer shows 7Y3A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.