7YIR: N-terminal PH domain of ARAP3 protein from human

Crystal structure of N-terminal PH domain of ARAP3 protein from human. Determined by X-ray diffraction at 2.1 Å resolution. Released 3 May 2023.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 842
Mol. weight: 13.16 kDa
Released: 3 May 2023

Explore 7YIR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7YIR contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-16	9	1
α-helix	17-19	3
β-strand	22-30	9	1
β-strand	34-38	5	1
β-strand	48-51	4	1
α-helix	52-54	3
β-strand	55-61	7	1
β-strand	65-70	6	1
β-strand	74-78	5	1
α-helix	82-100	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3	A	protein	111	Homo sapiens	Q8WWN8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7YIR_1 Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 (chains A)
MDRLTPLLSGWLDKLSPQGNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRS
SKDNKFQVITGQRVFVFRTESEAQRDMWCSTLQSCLKEQRLLGLEHHHHHH

Primary citation

Structural Insights Uncover the Specific Phosphoinositide Recognition by the PH1 Domain of Arap3. Zhang, Y., Ge, L., Xu, L. et al. Int J Mol Sci (2023) 24. DOI 10.3390/ijms24021125 · PubMed

Other PDB entries of the same protein (UniProt Q8WWN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A9B 2.0 Å, Crystal structure of Shank1 PDZ domain with ARAP3-derived peptide
5JCP 2.1 Å, RhoGAP domain of ARAP3 in complex with RhoA in the transition state
5JD0 2.3 Å, crystal structure of ARAP3 RhoGAP domain
7YIS 3.3 Å, Crystal structure of N-terminal PH domain of ARAP3 protein in complex with inositol…
2KG5 NMR Solution structure of ARAP3-SAM
2LNW Identification and structural basis for a novel interaction between Vav2 and Arap3

Browse structure collections

About this viewer

MolViewer shows 7YIR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.